Öffentliches Register
Software-GesundheitsberichtSchema 0.26.0 · Metriken 1.13.0 · 2026-07-22 09:24 UTC

peltmonger / create-stardrive

Create a new top-notch astro boilerplate to kick of your next high-speed website. LLM-friendly.

TypeScriptMIT★ 1 Stern⑂ 1 Forkseit Mai 2026Auf GitHub ansehen ↗

peltmonger/create-stardrive erreicht einen Gesundheitsindex von 52 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Vitality (74/100) ab, am schwächsten bei Community & Adoption (32/100). Zuletzt vor 4 Tagen aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.

52
gesamt / 100
Mittel

Software-Gesundheitsindex

Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.

52
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
VitalitätCommunity &VerbreitungNachhaltigkeit &GovernanceEngineering-QualitätSicherheitAI Readiness

Bewertungsprofil

Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.

Eigentümerschaft

PeltmongerOrganisation
1 Follower2 öffentliche Reposseit Juni 2022

Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.

Paket-Ökosysteme

RegistryPaketVersionDownloads / MonatVersionenZuletzt veröffentlichtTags
npmcreate-stardrive1.4.12.19016vor 4 Tagenastrostardrivejavascripttypescripthtmltailwindweblandingpagestartertemplateframeworkboilerplate

Metriken nach Kategorie

Vitalität

Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?

74Gut · 22 % des Gesamtindex
Wie die Bewertung erfolgt
36/36Push-Aktualität — letzter Push vor 4 Tagen
5.5/36Commit-Rhythmus — 8/52 Wochen mit Commits
15/18Commit-Volumen — 46 Commits im letzten Jahr
0/10OpenSSF Scorecard: Maintained — project was created within the last 90 days. Please review its contents carefully
Verwendete Eingangsdaten
commits_last_year46
human_commit_share1
days_since_last_push4
active_weeks_last_year8

Release-Disziplin

100Exzellent
Wie die Bewertung erfolgt
27/27Liefert Releases aus — 16 Releases veröffentlicht
36/36Release-Aktualität — letztes Release vor 4 Tagen
27/27Release-Rhythmus — ein Release etwa alle 2,3 Tage
0/10OpenSSF Scorecard: Signed-Releases — keine Daten
Verwendete Eingangsdaten
releases_count16
latest_release_tagv1.4.1
releases_from_tagsnein
days_since_latest_release4
mean_days_between_releases2,3
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.

Community & Verbreitung

Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?

32Gefährdet · 18 % des Gesamtindex
Wie die Bewertung erfolgt
0/60Stars — 1 Stars
0/25Forks — 1 Forks
0/15Watcher — 0 Watcher
Verwendete Eingangsdaten
forks1
stars1
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonbelow_threshold
Wie die Bewertung erfolgt
22.5/22.5README
22.5/22.5Lizenz — anerkannte Lizenz (MIT)
0/18CONTRIBUTING-Leitfaden
0/13.5Verhaltenskodex
0/7.2Issue-Vorlage
0/6.3PR-Vorlage
Verwendete Eingangsdaten
has_readmeja
has_licenseja
has_contributingnein
has_issue_templatenein
has_code_of_conductnein
has_pull_request_templatenein
Wie die Bewertung erfolgt
44.5/80Downloads pro Monat — 2.190 Downloads/Monat über npm
0/20Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen
Verwendete Eingangsdaten
packagescreate-stardrive
dependents
ecosystemsnpm
total_downloads
monthly_downloads2.190
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Abhängige in der Registry. Die verbleibenden Gewichte wurden renormalisiert.

Nachhaltigkeit & Governance

Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?

46Gefährdet · 24 % des Gesamtindex
Wie die Bewertung erfolgt
9/54Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab
0/22.5Commit-Verteilung — wichtigste beitragende Person verfasste 100 % der Commits
1.4/13.5Breite der Beitragenden — 1 Beitragende
0/10OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0
Verwendete Eingangsdaten
bus_factor1
contributors_sampled1
top_contributor_share1
Wie die Bewertung erfolgt
0/46.8Issue-Lösungsquote — keine Issues oder keine Daten
25.5/38.3PR-Annahme — 2/3 entschiedene PRs gemergt
0/15OpenSSF Scorecard: Code-Review — Found 0/29 approved changesets -- score normalized to 0
Verwendete Eingangsdaten
merged_prs2
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs1
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Issue-Lösungsquote. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
30/30Organisatorische Trägerschaft — im Besitz einer Organisation
0/20Verifizierte Domain
2.2/25Reichweite des Inhabers — 1 Follower von peltmonger
11.6/25Kontohistorie — 2 öffentliche Repos, Kontoalter ca. 4 Jahre
Verwendete Eingangsdaten
followers1
owner_typeOrganization
is_verified
owner_loginpeltmonger
public_repos2
account_age_days1.483

Paketpflege

100Exzellent
Wie die Bewertung erfolgt
25/25Veröffentlicht & auflösbar — 1 Paket(e) auf npm
35/35Veröffentlichungsaktualität — letzte Veröffentlichung vor 4 Tagen
20/20Versionshistorie — 16 veröffentlichte Versionen
20/20Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen
Verwendete Eingangsdaten
packagescreate-stardrive
ecosystemsnpm
any_deprecatednein
min_days_since_publish4

Engineering-Qualität

Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?

46Gefährdet · 20 % des Gesamtindex
Wie die Bewertung erfolgt
24/24CI-Workflows — 1 Workflow(s)
0/24Tests vorhanden
0/16Linter-Konfiguration
0/9.6Pre-Commit-Hooks
0/6.4.editorconfig
20/20OpenSSF Scorecard: CI-Tests — 1 out of 1 merged PRs checked by a CI test -- score normalized to 10
Verwendete Eingangsdaten
has_cija
has_testsnein
has_editorconfignein
has_linter_confignein
has_precommit_confignein
Wie die Bewertung erfolgt
30/30README
0/25Dokumentationsverzeichnis
0/15Dokumentations-/Homepage-Site
10/10Repository-Beschreibung
10/10Topics — 7 Topics
0/10Wiki
Verwendete Eingangsdaten
topicsastro, astro-boilerplate, astro-starter, astro-template, astrojs, boilerplate, starter
has_wikinein
homepage
has_readmeja
has_docs_dirnein
has_descriptionja

Sicherheit

Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?

60Mittel · 16 % des Gesamtindex
Wie die Bewertung erfolgt
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
2.5/2.5CI-Tests — 1 out of 1 merged PRs checked by a CI test -- score normalized to 10
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/29 approved changesets -- score normalized to 0
0/2.5Contributors — project has 0 contributing companies or organizations -- score normalized to 0
10/10Dangerous-Workflow — no dangerous workflow patterns detected
7.5/7.5Dependency-Update-Tool — update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Lizenz — license file detected
0/7.5Maintained — project was created within the last 90 days. Please review its contents carefully
0/5Packaging — keine Daten
1/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — keine Daten
7.5/7.5Token-Permissions — GitHub workflow tokens follow principle of least privilege
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Verwendete Eingangsdaten
sourceopenssf_scorecard
checks_evaluated16
scorecard_versionv5.5.0
checks_inconclusive2
scorecard_aggregate5
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): packaging, signed_releases. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
35/35Direkte Abhängigkeiten ohne bekannte Advisories — keine direkte Abhängigkeit trägt ein bekanntes Advisory
0/25Indirekte Abhängigkeiten ohne bekannte Advisories — transitive Menge in diesem Bereich nicht von Entwicklungs- und Test-Abhängigkeiten trennbar
0/40Keine offenen Advisories — kein Advisory trägt ein Veröffentlichungsdatum
Verwendete Eingangsdaten
sourceosv
advisories0
affected_packages0
assessed_packages30
unassessed_packages0
affected_by_severitynone
direct_affected_packages0
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Indirekte Abhängigkeiten ohne bekannte Advisories, Keine offenen Advisories. Die verbleibenden Gewichte wurden renormalisiert. 30 aufgelöste Abhängigkeiten wurden mit OSV abgeglichen. Dieses Repository veröffentlicht kein Paket, das der Index auflöst; bewertet wurde daher der Abhängigkeitsgraph des Repositorys. Dieser Graph vermischt Entwicklungs- und Test-Pins mit ausgelieferten Abhängigkeiten, daher werden nur die deklarierten Laufzeit-Abhängigkeiten bewertet; transitive Befunde werden als Kontext ausgewiesen und fließen nicht in die Bewertung ein. Erreichbarkeit wird nicht analysiert.

AI Readiness

Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.

50Mittel · 0 % des Gesamtindex
Wie die Bewertung erfolgt
45/45Agentenanweisungen — AGENTS.md, CLAUDE.md
0/15Maschinenlesbare Doku (llms.txt)
4.6/40Lesbare Commit-Historie — 4 von 46 menschlichen Commits benennen ihre Absicht (strukturierter Betreff oder erläuternder Text)
Verwendete Eingangsdaten
has_llms_txtnein
legible_history_share0,087
agent_instruction_filesAGENTS.md, CLAUDE.md
agent_instruction_max_bytes4.765
Wie die Bewertung erfolgt
0/18Bootstrap mit einem Befehl
0/22Automatisierte Tests
0/11Lint-/Format-Konfiguration
11/11Statische Typprüfung — tsconfig.json
10/10Reproduzierbare Umgebung — lockfile
4.3/10Belegte Agentenpraxis — 1 der letzten 46 Commits von Agenten verfasst oder ihnen zugeschrieben
5/8Automatisierte Wartung — Abhängigkeits-Automatisierung konfiguriert, in den erfassten Commits nicht beobachtet
2/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2
Verwendete Eingangsdaten
has_nixnein
has_testsnein
lockfilespackage-lock.json
has_dockerfilenein
typed_languageja
bootstrap_files
has_devcontainernein
has_linter_confignein
typecheck_configstsconfig.json
agent_commit_share0,022
toolchain_manifests
dependency_bot_commit_share0
Wie die Bewertung erfolgt
45/45Typprüfbarer Code — TypeScript (statisch typisiert)
55/55Handhabbare Dateigrößen — 0/10 Quelldateien über 60 KB
Verwendete Eingangsdaten
primary_languageTypeScript
largest_source_bytes13.237
source_files_sampled10
oversized_source_files0

Eckdaten

1GitHub-Sterne
1Mitwirkende
46Commits, letzte 12 Monate
4Tage seit letztem Push
16Releases
1Bus-Faktor
0offene Issues
npmPaket-Ökosysteme

Warnungen zur Datenerhebung

  • deps.dev does not index npm:create-stardrive@1.4.1; advisories assessed against the repository dependency graph instead

Weitere Details

OpenSSF Scorecard 5.0 / 10
5.0Gesamtwert

Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).Scorecard v5.5.0 · 2026-07-22 09:23 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
10CI-Tests1 out of 1 merged PRs checked by a CI test -- score normalized to 10
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/29 approved changesets -- score normalized to 0
0Contributorsproject has 0 contributing companies or organizations -- score normalized to 0
10Dangerous-Workflowno dangerous workflow patterns detected
10Dependency-Update-Toolupdate tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintainedproject was created within the last 90 days. Please review its contents carefully
k. A.Packagingpackaging workflow not detected
2Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 2
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
k. A.Signed-Releasesno releases found
10Token-PermissionsGitHub workflow tokens follow principle of least privilege
10Vulnerabilities0 existing vulnerabilities detected
Alle Abhängigkeiten 30

Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 0 direkte und 30 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.

RegistryPaketVersionBeziehung
npm@esbuild/aix-ppc640.28.1indirekt
npm@esbuild/android-arm0.28.1indirekt
npm@esbuild/android-arm640.28.1indirekt
npm@esbuild/android-x640.28.1indirekt
npm@esbuild/darwin-arm640.28.1indirekt
npm@esbuild/darwin-x640.28.1indirekt
npm@esbuild/freebsd-arm640.28.1indirekt
npm@esbuild/freebsd-x640.28.1indirekt
npm@esbuild/linux-arm0.28.1indirekt
npm@esbuild/linux-arm640.28.1indirekt
npm@esbuild/linux-ia320.28.1indirekt
npm@esbuild/linux-loong640.28.1indirekt
npm@esbuild/linux-mips64el0.28.1indirekt
npm@esbuild/linux-ppc640.28.1indirekt
npm@esbuild/linux-riscv640.28.1indirekt
npm@esbuild/linux-s390x0.28.1indirekt
npm@esbuild/linux-x640.28.1indirekt
npm@esbuild/netbsd-arm640.28.1indirekt
npm@esbuild/netbsd-x640.28.1indirekt
npm@esbuild/openbsd-arm640.28.1indirekt
npm@esbuild/openbsd-x640.28.1indirekt
npm@esbuild/openharmony-arm640.28.1indirekt
npm@esbuild/sunos-x640.28.1indirekt
npm@esbuild/win32-arm640.28.1indirekt
npm@esbuild/win32-ia320.28.1indirekt
npm@esbuild/win32-x640.28.1indirekt
npm@types/node26.1.1indirekt
npmesbuild0.28.1indirekt
npmtypescript6.0.3indirekt
npmundici-types8.3.0indirekt
Abhängigkeits-Advisories 0

Dieses Repository veröffentlicht kein vom Index auflösbares Paket, daher wurde sein eigener Abhängigkeitsgraph bewertet – 30 Pakete, darunter auch Entwicklungs- und Test-Pins, die nie ausgeliefert werden: 0 tragen bekannte Advisories, davon 0 direkte.

Keine bekannten Advisories betreffen die bewerteten Abhängigkeiten.

Ein Advisory bedeutet, dass die im Abhängigkeitsgraphen erfasste Version in den betroffenen Bereich eines Advisories fällt. Erreichbarkeit wird nicht analysiert, und der Graph enthält Entwicklungs- und Test-Pins — ein Fund kann das Werkzeug betreffen und nicht die ausgelieferte Software.

JSON-Rohbericht maschinenlesbar
{
  "data": {
    "repo": {
      "topics": [
        "astro",
        "astro-boilerplate",
        "astro-starter",
        "astro-template",
        "astrojs",
        "boilerplate",
        "starter"
      ],
      "is_fork": false,
      "size_kb": 178,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 350,
        "TypeScript": 25579
      },
      "pushed_at": "2026-07-17T10:39:54Z",
      "created_at": "2026-05-12T09:12:35Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-17T10:39:58Z",
      "description": "Create a new top-notch astro boilerplate to kick of your next high-speed website. LLM-friendly.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "TypeScript",
      "significant_languages": [
        "TypeScript"
      ]
    },
    "owner": {
      "blog": "https://peltmonger.com",
      "name": "Peltmonger",
      "type": "Organization",
      "login": "peltmonger",
      "company": null,
      "location": "Germany",
      "followers": 1,
      "avatar_url": "https://avatars.githubusercontent.com/u/108459341?v=4",
      "created_at": "2022-06-30T09:05:48Z",
      "is_verified": null,
      "public_repos": 2,
      "account_age_days": 1483
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.4.1",
          "kind": "patch",
          "published_at": "2026-07-17T10:30:31Z"
        },
        {
          "tag": "v1.4.0",
          "kind": "minor",
          "published_at": "2026-07-17T09:36:36Z"
        },
        {
          "tag": "v1.3.8",
          "kind": "patch",
          "published_at": "2026-07-15T08:25:51Z"
        },
        {
          "tag": "v1.3.7",
          "kind": "patch",
          "published_at": "2026-07-09T17:38:28Z"
        },
        {
          "tag": "v1.3.6",
          "kind": "patch",
          "published_at": "2026-07-09T09:56:20Z"
        },
        {
          "tag": "v1.3.5",
          "kind": "patch",
          "published_at": "2026-07-07T19:08:50Z"
        },
        {
          "tag": "v1.3.4",
          "kind": "patch",
          "published_at": "2026-07-07T18:48:32Z"
        },
        {
          "tag": "v1.3.3",
          "kind": "patch",
          "published_at": "2026-07-06T20:44:35Z"
        },
        {
          "tag": "v1.2.3",
          "kind": "patch",
          "published_at": "2026-06-26T23:35:42Z"
        },
        {
          "tag": "v1.2.2",
          "kind": "patch",
          "published_at": "2026-06-26T10:22:06Z"
        },
        {
          "tag": "v1.2.1",
          "kind": "patch",
          "published_at": "2026-06-24T11:39:43Z"
        },
        {
          "tag": "v1.2.0",
          "kind": "minor",
          "published_at": "2026-06-23T23:34:09Z"
        },
        {
          "tag": "v1.1.0",
          "kind": "minor",
          "published_at": "2026-06-12T11:57:44Z"
        },
        {
          "tag": "v1.0.2",
          "kind": "patch",
          "published_at": "2026-06-04T20:00:16Z"
        },
        {
          "tag": "v1.0.1",
          "kind": "patch",
          "published_at": "2026-06-04T19:45:35Z"
        },
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2026-06-04T19:30:28Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "9ab75d463841582b7c98d5ae6fcd8e15b7ad1ac4",
          "body": null,
          "is_bot": false,
          "headline": "one more line",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T10:39:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b2748dfe662bab9da021dd96e032b4058905b361",
          "body": null,
          "is_bot": false,
          "headline": "better blank line after removal handling; fixing droppedFeatures line",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T10:30:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7830e01e4be3b69777afd7a29f68401ed8ec40fa",
          "body": null,
          "is_bot": false,
          "headline": "droppedFeatures and better block removal",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T09:36:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "848be30079e4a5f47e844059ed7768cb434a4b28",
          "body": null,
          "is_bot": false,
          "headline": "optimizing gitignore and publish script",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:25:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "64a8f1526ff4cb512c8c712886cd4c78e35bbf3c",
          "body": null,
          "is_bot": false,
          "headline": "silencing install output",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:08:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ebef7c5e529c448fe2c380aa0bdb872ebaf58bdb",
          "body": null,
          "is_bot": false,
          "headline": "lower case optimization",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:05:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "642061bdaace3cad263d5a0ebebc142255a426a7",
          "body": null,
          "is_bot": false,
          "headline": "improving win compat",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-09T17:37:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f5b7a1598be628c78d112b74925cf833fa5db48",
          "body": null,
          "is_bot": false,
          "headline": "Fixing compatibility issues with Windows",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-09T09:41:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a508063fe088bae6bc34974b307df99c99d5c51",
          "body": null,
          "is_bot": false,
          "headline": "sponsoring option",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T19:56:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "277c0616fd04493c1a87dfc18f3bbfeece0016f3",
          "body": null,
          "is_bot": false,
          "headline": "Cloudflare fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T19:08:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7bcef54fc78a55e581622972859511289b3bc266",
          "body": null,
          "is_bot": false,
          "headline": "better cleanup with no features selected",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T18:47:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e75ed490c1a3fdf06b755578bdb17589e4853481",
          "body": null,
          "is_bot": false,
          "headline": "STARDRIVE_AGENT_MODE file fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-06T23:06:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "294b75cb2c89bd1c05ba0c4eea52cbd6eb41bb84",
          "body": null,
          "is_bot": false,
          "headline": "calibrating gitignore",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-06T20:43:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e3388f5384cb88ff58165032ae0b741d6f3710da",
          "body": null,
          "is_bot": false,
          "headline": "adjust to new component structure",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-02T18:45:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18b56ccaacae766b90db3316456906fc0ae56816",
          "body": null,
          "is_bot": false,
          "headline": "removing custom event sitemap",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T22:38:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "84c9ad3de31566b99e199fcae0d9041099e82475",
          "body": null,
          "is_bot": false,
          "headline": "adding event-bridge to be dropped in the event case",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T20:46:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "422f461d1fc3107c4fe47f229a45ba3d4e30415f",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T18:56:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9f4e29cc28b47debbc96f27bdcc737d665a71a9b",
          "body": null,
          "is_bot": false,
          "headline": "setAgentMode",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T08:00:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4e61ad459070858f7fce43d74e5238ce31704b40",
          "body": null,
          "is_bot": false,
          "headline": "faq fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T00:23:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "93ed13a55c65dc3814a312ecc76c28bb4afca52c",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T18:42:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f026327c9cf5377350501a890cb88ac4edcd4d3",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T12:47:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7abc3f632918c8cfd002de04264aa91fed7ecb12",
          "body": null,
          "is_bot": false,
          "headline": "clean-up for events feature",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T11:39:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3a21c8335bff0bc547f07d626900c3cb4de37666",
          "body": null,
          "is_bot": false,
          "headline": "typo",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-28T13:59:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "58843603314626d27acfc987df23368a0eb18227",
          "body": null,
          "is_bot": false,
          "headline": "agents.md fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-28T13:55:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "51e837fc376dbec6f09186925f5541f8763459cf",
          "body": null,
          "is_bot": false,
          "headline": "minor fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-26T23:09:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f3a0f6e9961b8036993d67b52a7f8b2984c0bab5",
          "body": null,
          "is_bot": false,
          "headline": "also drop _redirects on CF disable",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-26T10:21:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ce22427d5c7534a95e776a34e7037ff55de62480",
          "body": null,
          "is_bot": false,
          "headline": "minor scaffold fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-24T11:24:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0301d2cb71c65530295059205638dcd8741b9d5e",
          "body": null,
          "is_bot": false,
          "headline": "feature trim guide",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-23T23:33:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f7e478534bfe982a7ea6cff0ea7326bc9d07dae",
          "body": "minor updates",
          "is_bot": false,
          "headline": "Merge pull request #3 from Peltmonger/docs/publishing-flow",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-21T21:28:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3341e6bb962283fd10286659e758f79362d19e1f",
          "body": null,
          "is_bot": false,
          "headline": "minor updates",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-21T21:27:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bce6973004317ae860b95bacbe80a24593adf398",
          "body": null,
          "is_bot": false,
          "headline": "better llm docs",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T12:06:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "37a92b4859e46e0eb1295ed2818213b4baf805ac",
          "body": null,
          "is_bot": false,
          "headline": "claude.md",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T12:04:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "338c28f8b4f63a5b323b9b9e3fbef6c3194fd818",
          "body": "Making it a TS project",
          "is_bot": false,
          "headline": "Bump version from 1.0.2 to 1.1.0",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:57:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a0647ad74677cf60ad6af9672c2dbace79eb96a4",
          "body": "Convert CLI to TypeScript with esbuild build step",
          "is_bot": false,
          "headline": "Merge pull request #1 from Peltmonger/worktree-ts-rewrite",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:56:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0dec6b93eada11d0c97e1f491d47c9c735ac8b38",
          "body": null,
          "is_bot": false,
          "headline": "Fix script formatting in package.json",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:55:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d549fce98bb52190707d708ab2bc1378cd1372a6",
          "body": "Splits the single bin/index.js into typed modules under src/ and bundles\nback to bin/index.js via esbuild. The published artifact is unchanged\nbehaviorally; bin/index.js is now generated and gitignored.\n\n- src/{index,logger,args,package-manager,project-name,release,scaffold,types}.ts\n- build.mjs: es\n[…]\njs\"]), engines >=18,\n  scripts: build, typecheck, prepublishOnly\n- npm-publish workflow: npm ci + npm run build before npm publish\n\nCo-Authored-By: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "typescript rewrite with esbuild build",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:41:03Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "76ce4bc0dfe657459f93abbf63cd58d96df5eec1",
          "body": null,
          "is_bot": false,
          "headline": "readme fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T20:00:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fb3355b797bf5393402d5adffdc74343160f3aa3",
          "body": null,
          "is_bot": false,
          "headline": "v up",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:59:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b17f824dc49f82215b7285e4f48e76c82a1b573f",
          "body": null,
          "is_bot": false,
          "headline": "no detached warning",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:58:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "eafcd678b45c58a4c2880f0c10d6c6b50f06840d",
          "body": null,
          "is_bot": false,
          "headline": "slimer publish",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:43:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "cfdc04a868ae7de18d8874ced9797b092e919af2",
          "body": null,
          "is_bot": false,
          "headline": "smoother cli flow",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:41:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5c9673aa8b0e3af43c1d3e7903b81f695091a0b5",
          "body": null,
          "is_bot": false,
          "headline": "fix script",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:29:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6447a5abff0c93312248b2548c5c004116481636",
          "body": null,
          "is_bot": false,
          "headline": "readme fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:27:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6866c7e3cdc0151a36669b7d53fafe2587e67570",
          "body": null,
          "is_bot": false,
          "headline": "initial version",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:23:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fb60441afd50dcf93a73da9e182a9a383ff613b7",
          "body": "Updated Dependabot configuration to enable npm updates and changed schedule to monthly.",
          "is_bot": false,
          "headline": "Enable npm updates and change schedule to monthly",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-05-12T09:18:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b11a061c02b2c1d6f68ce8885179b4e797faeda6",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-05-12T09:12:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 16,
      "commits_last_year": 46,
      "latest_release_at": "2026-07-17T10:30:31Z",
      "latest_release_tag": "v1.4.1",
      "releases_from_tags": false,
      "days_since_last_push": 4,
      "active_weeks_last_year": 8,
      "days_since_latest_release": 4,
      "mean_days_between_releases": 2.3
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "create-stardrive",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "astro",
            "stardrive",
            "javascript",
            "typescript",
            "html",
            "tailwind",
            "web",
            "landingpage",
            "starter",
            "template",
            "framework",
            "boilerplate"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/create-stardrive",
          "is_deprecated": false,
          "latest_version": "1.4.1",
          "repository_url": "https://github.com/peltmonger/create-stardrive",
          "versions_count": 16,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 2190,
          "first_published_at": "2026-06-04T19:33:13.337000Z",
          "latest_published_at": "2026-07-17T10:30:43.470000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 4
        }
      ]
    },
    "popularity": {
      "forks": 1,
      "stars": 1,
      "watchers": 0,
      "fork_history": {
        "days": [
          {
            "date": "2026-07-10",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_forks": 1
      },
      "star_history": {
        "days": [
          {
            "date": "2026-07-10",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_stars": 1
      },
      "open_issues_and_prs": 0
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "tsconfig.json"
      ],
      "toolchain_manifests": [],
      "largest_source_bytes": 13237,
      "source_files_sampled": 10,
      "oversized_source_files": 0,
      "agent_instruction_files": [
        "AGENTS.md",
        "CLAUDE.md"
      ],
      "agent_instruction_max_bytes": 4765
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "repository_graph",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 30,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "@esbuild/aix-ppc64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-arm",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/darwin-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/darwin-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/freebsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/freebsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-arm",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-ia32",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-loong64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-mips64el",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-ppc64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-riscv64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-s390x",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/netbsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/netbsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openbsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openbsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openharmony-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/sunos-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-ia32",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@types/node",
            "direct": false,
            "version": "26.1.1",
            "ecosystem": "npm"
          },
          {
            "name": "esbuild",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "typescript",
            "direct": false,
            "version": "6.0.3",
            "ecosystem": "npm"
          },
          {
            "name": "undici-types",
            "direct": false,
            "version": "8.3.0",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 30,
        "direct_count": 0,
        "indirect_count": 30
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 2,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 1
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "jekuer",
          "commits": 46,
          "avatar_url": "https://avatars.githubusercontent.com/u/8572883?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": false,
      "ci_workflows": [
        "npm-publish.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [
        "package-lock.json"
      ],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 10,
            "reason": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/29 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 0,
            "reason": "project has 0 contributing companies or organizations -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 10,
            "reason": "update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "project was created within the last 90 days. Please review its contents carefully",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 2,
            "reason": "dependency not pinned by hash detected -- score normalized to 2",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 10,
            "reason": "GitHub workflow tokens follow principle of least privilege",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "9ab75d463841582b7c98d5ae6fcd8e15b7ad1ac4",
        "ran_at": "2026-07-22T09:23:54Z",
        "aggregate_score": 5,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": true
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-17T10:41:07Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": "2026-06-21T21:28:08Z",
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": []
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/peltmonger/create-stardrive",
    "host": "github.com",
    "name": "create-stardrive",
    "owner": "peltmonger"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 52,
      "inputs": {
        "security": 60,
        "vitality": 74,
        "community": 32,
        "governance": 46,
        "engineering": 46
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 74,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 56,
            "inputs": {
              "commits_last_year": 46,
              "human_commit_share": 1,
              "days_since_last_push": 4,
              "active_weeks_last_year": 8
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "8/52 weeks with commits",
                "points": 5.5,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 8
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "46 commits in the last year",
                "points": 15,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 46
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "project was created within the last 90 days. Please review its contents carefully",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "releases_count": 16,
              "latest_release_tag": "v1.4.1",
              "releases_from_tags": false,
              "days_since_latest_release": 4,
              "mean_days_between_releases": 2.3
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "16 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 16
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~2.3 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 2.3
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "at_risk",
        "name": "Community & Adoption",
        "value": 32,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 1,
              "stars": 1,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "below_threshold"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "1 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "1 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 56,
            "inputs": {
              "packages": [
                "create-stardrive"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 2190
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "2,190 downloads/month across npm",
                "points": 44.5,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 2190,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 46,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 10,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "at_risk",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 48,
            "inputs": {
              "merged_prs": 2,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 1
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "2/3 decided PRs merged",
                "points": 25.5,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 2,
                      "decided": 3
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/29 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "at_risk",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "followers": 1,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "peltmonger",
              "public_repos": 2,
              "account_age_days": 1483
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "1 followers of peltmonger",
                "points": 2.2,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 1,
                      "login": "peltmonger"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "2 public repos, account ~4 yr old",
                "points": 11.6,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 2
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 4
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "create-stardrive"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 4
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 4 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "16 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 16
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "at_risk",
        "name": "Engineering Quality",
        "value": 46,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "at_risk",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "has_ci": true,
              "has_tests": false,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "1 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "astro",
                "astro-boilerplate",
                "astro-starter",
                "astro-template",
                "astrojs",
                "boilerplate",
                "starter"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "7 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 7
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 60,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "moderate",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 50,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 16,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 2,
              "scorecard_aggregate": 5
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/29 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "update tool detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "project was created within the last 90 days. Please review its contents carefully",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 2",
                "points": 1,
                "status": "partial",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "GitHub workflow tokens follow principle of least privilege",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 30 resolved dependencies against OSV. This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "indirect_dependencies_free_of_known_advisories",
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_repository",
                "params": {
                  "assessed": 30
                }
              },
              {
                "code": "advisories_repo_graph_caveat",
                "params": {}
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 30,
              "unassessed_packages": 0,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "transitive set not separable from development and test dependencies in this scope",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_scope_not_separable",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 30,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 2
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "moderate",
        "name": "AI Readiness",
        "value": 50,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "moderate",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0.087,
              "agent_instruction_files": [
                "AGENTS.md",
                "CLAUDE.md"
              ],
              "agent_instruction_max_bytes": 4765
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "AGENTS.md, CLAUDE.md",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "AGENTS.md, CLAUDE.md"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "4 of 46 human commits state their intent (structured subject or explanatory body)",
                "points": 4.6,
                "status": "partial",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 4,
                      "sampled": 46
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": null,
            "notes": [],
            "value": 32,
            "inputs": {
              "has_nix": false,
              "has_tests": false,
              "lockfiles": [
                "package-lock.json"
              ],
              "has_dockerfile": false,
              "typed_language": true,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [
                "tsconfig.json"
              ],
              "agent_commit_share": 0.022,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "lockfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "lockfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "1 of the last 46 commits agent-authored or agent-credited",
                "points": 4.3,
                "status": "partial",
                "details": [
                  {
                    "code": "agent_authored_commits",
                    "params": {
                      "count": 1,
                      "sampled": 46
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "dependency automation configured, none observed in the sampled commits",
                "points": 5,
                "status": "partial",
                "details": [
                  {
                    "code": "dependency_bot_config_only",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 2",
                "points": 2,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "excellent",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "primary_language": "TypeScript",
              "largest_source_bytes": 13237,
              "source_files_sampled": 10,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "TypeScript (statically typed)",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "TypeScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/10 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 10,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "deps.dev does not index npm:create-stardrive@1.4.1; advisories assessed against the repository dependency graph instead"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T09:24:00.880826Z",
  "schema_version": "0.26.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/p/peltmonger/create-stardrive.svg",
  "full_name": "peltmonger/create-stardrive",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.

Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.26.0 — vollständige Methodik · Metriken-Wiki.

Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistikennpm.