Публічний реєстрПомірний
Звіт про здоров'я програмного забезпеченнясхема 0.26.0 · метрики 1.13.0 · 2026-07-22 09:24 UTC
peltmonger / create-stardrive
Create a new top-notch astro boilerplate to kick of your next high-speed website. LLM-friendly.
peltmonger/create-stardrive має індекс здоров’я 52 зі 100, що відповідає смузі «Помірний». Найвищий показник — Vitality (74/100), найнижчий — Community & Adoption (32/100). Останнє оновлення було 4 дні тому. Більшість нещодавньої роботи виконує один учасник.
52
загалом / 100Індекс здоров'я програмного забезпечення
Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.
52
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
Профіль оцінок
Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.
Власність
PeltmongerОрганізація
1 підписник2 публічні репозиторіїз черв. 2022 р.
За цим репозиторієм стоїть організація — спільна, підзвітна опіка, здатна пережити будь-якого окремого мейнтейнера.
Пакетні екосистеми
| Реєстр | Пакет | Версія | Завантажень / міс | Версії | Остання публікація | Теги |
|---|---|---|---|---|---|---|
| npm | create-stardrive | 1.4.1 | 2 190 | 16 | 4 дні тому | astrostardrivejavascripttypescripthtmltailwindweblandingpagestartertemplateframeworkboilerplate |
Метрики за категоріями
Життєздатність
Чи живий проєкт — чи пишеться код і чи виходять релізи?
74
Активність розробки
56Помірний
Як обчислюється оцінка
| 36/36 | Свіжість push — останній push 4 дн. тому |
| 5.5/36 | Ритм комітів — 8/52 тижнів із комітами |
| 15/18 | Обсяг комітів — 46 комітів за останній рік |
| 0/10 | OpenSSF Scorecard: Maintained — project was created within the last 90 days. Please review its contents carefully |
Використані вхідні дані
| commits_last_year | 46 |
| human_commit_share | 1 |
| days_since_last_push | 4 |
| active_weeks_last_year | 8 |
Дисципліна релізів
100Відмінний
Як обчислюється оцінка
| 27/27 | Випускає релізи — опубліковано 16 релізів |
| 36/36 | Свіжість релізів — останній реліз 4 дн. тому |
| 27/27 | Ритм релізів — реліз кожні ~2,3 дн. |
| 0/10 | OpenSSF Scorecard: Signed-Releases — немає даних |
Використані вхідні дані
| releases_count | 16 |
| latest_release_tag | v1.4.1 |
| releases_from_tags | ні |
| days_since_latest_release | 4 |
| mean_days_between_releases | 2,3 |
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: Signed-Releases. Залишкові ваги перенормовано.
Спільнота та впровадження
Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?
32
Популярність і впровадження
1Критичний
Як обчислюється оцінка
| 0/60 | Зірки — 1 зірок |
| 0/25 | Форки — 1 форків |
| 0/15 | Спостерігачі — 0 спостерігачів |
Використані вхідні дані
| forks | 1 |
| stars | 1 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | below_threshold |
Здоров'я спільноти
50Помірний
Як обчислюється оцінка
| 22.5/22.5 | README |
| 22.5/22.5 | Ліцензія — визнана ліцензія (MIT) |
| 0/18 | Настанови CONTRIBUTING |
| 0/13.5 | Кодекс поведінки |
| 0/7.2 | Шаблон issue |
| 0/6.3 | Шаблон PR |
Використані вхідні дані
| has_readme | так |
| has_license | так |
| has_contributing | ні |
| has_issue_template | ні |
| has_code_of_conduct | ні |
| has_pull_request_template | ні |
Впровадження в екосистемі (завантаження)
56Помірний
Як обчислюється оцінка
| 44.5/80 | Щомісячні завантаження — 2 190 завантажень/місяць у npm |
| 0/20 | Залежні пакети в реєстрі — ця екосистема цього не повідомляє |
Використані вхідні дані
| packages | create-stardrive |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 2 190 |
Виключено з оцінювання (немає даних або не застосовно): Залежні пакети в реєстрі. Залишкові ваги перенормовано.
Сталість та врядування
Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?
46
Стійкість мейнтейнерів (бас-фактор)
10Критичний
Як обчислюється оцінка
| 9/54 | Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів |
| 0/22.5 | Розподіл комітів — головний контриб’ютор — автор 100% комітів |
| 1.4/13.5 | Широта контриб’юторів — 1 контриб’юторів |
| 0/10 | OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
Використані вхідні дані
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
Реактивність на issue та PR
48У зоні ризику
Як обчислюється оцінка
| 0/46.8 | Вирішення issue — немає issue або даних |
| 25.5/38.3 | Прийняття PR — злито 2/3 вирішених PR |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/29 approved changesets -- score normalized to 0 |
Використані вхідні дані
| merged_prs | 2 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 1 |
Виключено з оцінювання (немає даних або не застосовно): Вирішення issue. Залишкові ваги перенормовано.
Власність та опіка
44У зоні ризику
Як обчислюється оцінка
| 30/30 | Підтримка власника — у власності організації |
| 0/20 | Верифікований домен |
| 2.2/25 | Охоплення власника — 1 підписників у peltmonger |
| 11.6/25 | Послужний список — 2 публічних репозиторіїв, вік облікового запису ~4 р. |
Використані вхідні дані
| followers | 1 |
| owner_type | Organization |
| is_verified | — |
| owner_login | peltmonger |
| public_repos | 2 |
| account_age_days | 1 483 |
Супровід пакетів
100Відмінний
Як обчислюється оцінка
| 25/25 | Опубліковано й доступно — 1 пакет(ів) у npm |
| 35/35 | Свіжість публікацій — остання публікація 4 дн. тому |
| 20/20 | Історія версій — 16 опублікованих версій |
| 20/20 | Не застарілий — активний, не deprecated і не yanked |
Використані вхідні дані
| packages | create-stardrive |
| ecosystems | npm |
| any_deprecated | ні |
| min_days_since_publish | 4 |
Інженерна якість
Чи наявні базові інженерні практики та документація?
46
Інженерні практики
44У зоні ризику
Як обчислюється оцінка
| 24/24 | Процеси CI — 1 процес(ів) CI |
| 0/24 | Наявні тести |
| 0/16 | Конфігурація лінтера |
| 0/9.6 | Pre-commit-хуки |
| 0/6.4 | .editorconfig |
| 20/20 | OpenSSF Scorecard: CI-Tests — 1 out of 1 merged PRs checked by a CI test -- score normalized to 10 |
Використані вхідні дані
| has_ci | так |
| has_tests | ні |
| has_editorconfig | ні |
| has_linter_config | ні |
| has_precommit_config | ні |
Документація
50Помірний
Як обчислюється оцінка
| 30/30 | README |
| 0/25 | Каталог документації |
| 0/15 | Сайт документації / домашня сторінка |
| 10/10 | Опис репозиторію |
| 10/10 | Теми — 7 тем |
| 0/10 | Wiki |
Використані вхідні дані
| topics | astro, astro-boilerplate, astro-starter, astro-template, astrojs, boilerplate, starter |
| has_wiki | ні |
| homepage | — |
| has_readme | так |
| has_docs_dir | ні |
| has_description | так |
Безпека
Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?
60
Стан безпеки
50Помірний
Як обчислюється оцінка
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 2.5/2.5 | CI-Tests — 1 out of 1 merged PRs checked by a CI test -- score normalized to 10 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/29 approved changesets -- score normalized to 0 |
| 0/2.5 | Contributors — project has 0 contributing companies or organizations -- score normalized to 0 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 7.5/7.5 | Dependency-Update-Tool — update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Ліцензія — license file detected |
| 0/7.5 | Maintained — project was created within the last 90 days. Please review its contents carefully |
| 0/5 | Packaging — немає даних |
| 1/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2 |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — немає даних |
| 7.5/7.5 | Token-Permissions — GitHub workflow tokens follow principle of least privilege |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Використані вхідні дані
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 5 |
Виключено з оцінювання (немає даних або не застосовно): packaging, signed_releases. Залишкові ваги перенормовано.
Сповіщення про залежності
100Відмінний
Як обчислюється оцінка
| 35/35 | Прямі залежності без відомих сповіщень — жодна пряма залежність не має відомих сповіщень |
| 0/25 | Непрямі залежності без відомих сповіщень — транзитивний набір не відокремлюється від залежностей розробки й тестування в цьому обсязі |
| 0/40 | Немає задавнених сповіщень — жодне сповіщення не має дати публікації |
Використані вхідні дані
| source | osv |
| advisories | 0 |
| affected_packages | 0 |
| assessed_packages | 30 |
| unassessed_packages | 0 |
| affected_by_severity | none |
| direct_affected_packages | 0 |
Виключено з оцінювання (немає даних або не застосовно): Непрямі залежності без відомих сповіщень, Немає задавнених сповіщень. Залишкові ваги перенормовано. Звірено 30 резолвлених залежностей із OSV. Цей репозиторій не публікує пакета, який резолвить індекс, тож натомість оцінено граф залежностей репозиторію. Цей граф змішує закріплені версії для розробки й тестування зі справді постачаними залежностями, тож оцінюються лише задекларовані runtime-залежності; транзитивні знахідки подаються як контекст і в оцінку не входять. Досяжність не аналізується.
Готовність до ШІ
Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.
50
Контекст і настанови для агентів
50Помірний
Як обчислюється оцінка
| 45/45 | Інструкції для агентів — AGENTS.md, CLAUDE.md |
| 0/15 | Машиночитана документація (llms.txt) |
| 4.6/40 | Читабельна історія комітів — намір зазначено у 4 з 46 людських комітів (структурований заголовок або пояснювальний текст) |
Використані вхідні дані
| has_llms_txt | ні |
| legible_history_share | 0,087 |
| agent_instruction_files | AGENTS.md, CLAUDE.md |
| agent_instruction_max_bytes | 4 765 |
Цикл верифікації (збірка / тести / перевірка типів)
32У зоні ризику
Як обчислюється оцінка
| 0/18 | Розгортання однією командою |
| 0/22 | Автоматизовані тести |
| 0/11 | Конфігурація лінтера / форматера |
| 11/11 | Статична перевірка типів — tsconfig.json |
| 10/10 | Відтворюване середовище — lockfile |
| 4.3/10 | Підтверджена практика роботи з агентами — 1 з останніх 46 комітів створено агентом або з його зазначенням |
| 5/8 | Автоматизоване супроводження — автоматизацію залежностей налаштовано, але у вибірці комітів її не видно |
| 2/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2 |
Використані вхідні дані
| has_nix | ні |
| has_tests | ні |
| lockfiles | package-lock.json |
| has_dockerfile | ні |
| typed_language | так |
| bootstrap_files | — |
| has_devcontainer | ні |
| has_linter_config | ні |
| typecheck_configs | tsconfig.json |
| agent_commit_share | 0,022 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Читабельність коду для моделей
100Відмінний
Як обчислюється оцінка
| 45/45 | Типізований код — TypeScript (статично типізована) |
| 55/55 | Керовані розміри файлів — 0/10 файлів вихідного коду понад 60 КБ |
Використані вхідні дані
| primary_language | TypeScript |
| largest_source_bytes | 13 237 |
| source_files_sampled | 10 |
| oversized_source_files | 0 |
Ключові факти
1зірок GitHub
1контриб'юторів
46комітів за останні 12 місяців
4днів від останнього пушу
16релізів
1бас-фактор
0відкритих issue
npmпакетних екосистем
Попередження щодо збору даних
- deps.dev does not index npm:create-stardrive@1.4.1; advisories assessed against the repository dependency graph instead
Докладніше
OpenSSF Scorecard 5.0 / 10
5.0сукупно
Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 10 | CI-Tests | 1 out of 1 merged PRs checked by a CI test -- score normalized to 10 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/29 approved changesets -- score normalized to 0 |
| 0 | Contributors | project has 0 contributing companies or organizations -- score normalized to 0 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 10 | Dependency-Update-Tool | update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 0 | Maintained | project was created within the last 90 days. Please review its contents carefully |
| н/д | Packaging | packaging workflow not detected |
| 2 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 2 |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| н/д | Signed-Releases | no releases found |
| 10 | Token-Permissions | GitHub workflow tokens follow principle of least privilege |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Усі залежності 30
Повний розв'язаний набір залежностей із графа залежностей GitHub: 0 прямих і 30 непрямих (транзитивних) пакетів. Транзитивне замикання є повним, коли в репозиторії закомічено lockfile.
| Реєстр | Пакет | Версія | Зв'язок |
|---|---|---|---|
| npm | @esbuild/aix-ppc64 | 0.28.1 | непряма |
| npm | @esbuild/android-arm | 0.28.1 | непряма |
| npm | @esbuild/android-arm64 | 0.28.1 | непряма |
| npm | @esbuild/android-x64 | 0.28.1 | непряма |
| npm | @esbuild/darwin-arm64 | 0.28.1 | непряма |
| npm | @esbuild/darwin-x64 | 0.28.1 | непряма |
| npm | @esbuild/freebsd-arm64 | 0.28.1 | непряма |
| npm | @esbuild/freebsd-x64 | 0.28.1 | непряма |
| npm | @esbuild/linux-arm | 0.28.1 | непряма |
| npm | @esbuild/linux-arm64 | 0.28.1 | непряма |
| npm | @esbuild/linux-ia32 | 0.28.1 | непряма |
| npm | @esbuild/linux-loong64 | 0.28.1 | непряма |
| npm | @esbuild/linux-mips64el | 0.28.1 | непряма |
| npm | @esbuild/linux-ppc64 | 0.28.1 | непряма |
| npm | @esbuild/linux-riscv64 | 0.28.1 | непряма |
| npm | @esbuild/linux-s390x | 0.28.1 | непряма |
| npm | @esbuild/linux-x64 | 0.28.1 | непряма |
| npm | @esbuild/netbsd-arm64 | 0.28.1 | непряма |
| npm | @esbuild/netbsd-x64 | 0.28.1 | непряма |
| npm | @esbuild/openbsd-arm64 | 0.28.1 | непряма |
| npm | @esbuild/openbsd-x64 | 0.28.1 | непряма |
| npm | @esbuild/openharmony-arm64 | 0.28.1 | непряма |
| npm | @esbuild/sunos-x64 | 0.28.1 | непряма |
| npm | @esbuild/win32-arm64 | 0.28.1 | непряма |
| npm | @esbuild/win32-ia32 | 0.28.1 | непряма |
| npm | @esbuild/win32-x64 | 0.28.1 | непряма |
| npm | @types/node | 26.1.1 | непряма |
| npm | esbuild | 0.28.1 | непряма |
| npm | typescript | 6.0.3 | непряма |
| npm | undici-types | 8.3.0 | непряма |
Сповіщення про залежності 0
Цей репозиторій не публікує пакета, який розпізнає індекс, тож оцінено його власний граф залежностей — 30 пакетів, серед яких є й піниї розробки та тестування, що ніколи не постачаються: 0 мають відомі сповіщення, з них 0 прямі.
Жодне відоме сповіщення не стосується оцінених залежностей.
Сповіщення означає, що версія, записана в графі залежностей, потрапляє в уражений діапазон. Досяжність не аналізується, а граф містить піниї розробки й тестування — знахідка може стосуватися інструментів, а не поставленого коду.
Звіт у форматі JSON машиночитний
{
"data": {
"repo": {
"topics": [
"astro",
"astro-boilerplate",
"astro-starter",
"astro-template",
"astrojs",
"boilerplate",
"starter"
],
"is_fork": false,
"size_kb": 178,
"has_wiki": false,
"homepage": null,
"languages": {
"JavaScript": 350,
"TypeScript": 25579
},
"pushed_at": "2026-07-17T10:39:54Z",
"created_at": "2026-05-12T09:12:35Z",
"owner_type": "Organization",
"updated_at": "2026-07-17T10:39:58Z",
"description": "Create a new top-notch astro boilerplate to kick of your next high-speed website. LLM-friendly.",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "TypeScript",
"significant_languages": [
"TypeScript"
]
},
"owner": {
"blog": "https://peltmonger.com",
"name": "Peltmonger",
"type": "Organization",
"login": "peltmonger",
"company": null,
"location": "Germany",
"followers": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/108459341?v=4",
"created_at": "2022-06-30T09:05:48Z",
"is_verified": null,
"public_repos": 2,
"account_age_days": 1483
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v1.4.1",
"kind": "patch",
"published_at": "2026-07-17T10:30:31Z"
},
{
"tag": "v1.4.0",
"kind": "minor",
"published_at": "2026-07-17T09:36:36Z"
},
{
"tag": "v1.3.8",
"kind": "patch",
"published_at": "2026-07-15T08:25:51Z"
},
{
"tag": "v1.3.7",
"kind": "patch",
"published_at": "2026-07-09T17:38:28Z"
},
{
"tag": "v1.3.6",
"kind": "patch",
"published_at": "2026-07-09T09:56:20Z"
},
{
"tag": "v1.3.5",
"kind": "patch",
"published_at": "2026-07-07T19:08:50Z"
},
{
"tag": "v1.3.4",
"kind": "patch",
"published_at": "2026-07-07T18:48:32Z"
},
{
"tag": "v1.3.3",
"kind": "patch",
"published_at": "2026-07-06T20:44:35Z"
},
{
"tag": "v1.2.3",
"kind": "patch",
"published_at": "2026-06-26T23:35:42Z"
},
{
"tag": "v1.2.2",
"kind": "patch",
"published_at": "2026-06-26T10:22:06Z"
},
{
"tag": "v1.2.1",
"kind": "patch",
"published_at": "2026-06-24T11:39:43Z"
},
{
"tag": "v1.2.0",
"kind": "minor",
"published_at": "2026-06-23T23:34:09Z"
},
{
"tag": "v1.1.0",
"kind": "minor",
"published_at": "2026-06-12T11:57:44Z"
},
{
"tag": "v1.0.2",
"kind": "patch",
"published_at": "2026-06-04T20:00:16Z"
},
{
"tag": "v1.0.1",
"kind": "patch",
"published_at": "2026-06-04T19:45:35Z"
},
{
"tag": "v1.0.0",
"kind": "major",
"published_at": "2026-06-04T19:30:28Z"
}
],
"recent_commits": [
{
"oid": "9ab75d463841582b7c98d5ae6fcd8e15b7ad1ac4",
"body": null,
"is_bot": false,
"headline": "one more line",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-17T10:39:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b2748dfe662bab9da021dd96e032b4058905b361",
"body": null,
"is_bot": false,
"headline": "better blank line after removal handling; fixing droppedFeatures line",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-17T10:30:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7830e01e4be3b69777afd7a29f68401ed8ec40fa",
"body": null,
"is_bot": false,
"headline": "droppedFeatures and better block removal",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-17T09:36:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "848be30079e4a5f47e844059ed7768cb434a4b28",
"body": null,
"is_bot": false,
"headline": "optimizing gitignore and publish script",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-15T08:25:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "64a8f1526ff4cb512c8c712886cd4c78e35bbf3c",
"body": null,
"is_bot": false,
"headline": "silencing install output",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-15T08:08:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ebef7c5e529c448fe2c380aa0bdb872ebaf58bdb",
"body": null,
"is_bot": false,
"headline": "lower case optimization",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-15T08:05:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "642061bdaace3cad263d5a0ebebc142255a426a7",
"body": null,
"is_bot": false,
"headline": "improving win compat",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-09T17:37:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1f5b7a1598be628c78d112b74925cf833fa5db48",
"body": null,
"is_bot": false,
"headline": "Fixing compatibility issues with Windows",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-09T09:41:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7a508063fe088bae6bc34974b307df99c99d5c51",
"body": null,
"is_bot": false,
"headline": "sponsoring option",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-07T19:56:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "277c0616fd04493c1a87dfc18f3bbfeece0016f3",
"body": null,
"is_bot": false,
"headline": "Cloudflare fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-07T19:08:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7bcef54fc78a55e581622972859511289b3bc266",
"body": null,
"is_bot": false,
"headline": "better cleanup with no features selected",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-07T18:47:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e75ed490c1a3fdf06b755578bdb17589e4853481",
"body": null,
"is_bot": false,
"headline": "STARDRIVE_AGENT_MODE file fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-06T23:06:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "294b75cb2c89bd1c05ba0c4eea52cbd6eb41bb84",
"body": null,
"is_bot": false,
"headline": "calibrating gitignore",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-06T20:43:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e3388f5384cb88ff58165032ae0b741d6f3710da",
"body": null,
"is_bot": false,
"headline": "adjust to new component structure",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-02T18:45:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "18b56ccaacae766b90db3316456906fc0ae56816",
"body": null,
"is_bot": false,
"headline": "removing custom event sitemap",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-01T22:38:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "84c9ad3de31566b99e199fcae0d9041099e82475",
"body": null,
"is_bot": false,
"headline": "adding event-bridge to be dropped in the event case",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-01T20:46:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "422f461d1fc3107c4fe47f229a45ba3d4e30415f",
"body": null,
"is_bot": false,
"headline": "fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-01T18:56:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9f4e29cc28b47debbc96f27bdcc737d665a71a9b",
"body": null,
"is_bot": false,
"headline": "setAgentMode",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-01T08:00:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4e61ad459070858f7fce43d74e5238ce31704b40",
"body": null,
"is_bot": false,
"headline": "faq fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-07-01T00:23:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "93ed13a55c65dc3814a312ecc76c28bb4afca52c",
"body": null,
"is_bot": false,
"headline": "fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-29T18:42:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1f026327c9cf5377350501a890cb88ac4edcd4d3",
"body": null,
"is_bot": false,
"headline": "fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-29T12:47:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7abc3f632918c8cfd002de04264aa91fed7ecb12",
"body": null,
"is_bot": false,
"headline": "clean-up for events feature",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-29T11:39:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3a21c8335bff0bc547f07d626900c3cb4de37666",
"body": null,
"is_bot": false,
"headline": "typo",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-28T13:59:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "58843603314626d27acfc987df23368a0eb18227",
"body": null,
"is_bot": false,
"headline": "agents.md fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-28T13:55:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "51e837fc376dbec6f09186925f5541f8763459cf",
"body": null,
"is_bot": false,
"headline": "minor fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-26T23:09:43Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f3a0f6e9961b8036993d67b52a7f8b2984c0bab5",
"body": null,
"is_bot": false,
"headline": "also drop _redirects on CF disable",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-26T10:21:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ce22427d5c7534a95e776a34e7037ff55de62480",
"body": null,
"is_bot": false,
"headline": "minor scaffold fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-24T11:24:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0301d2cb71c65530295059205638dcd8741b9d5e",
"body": null,
"is_bot": false,
"headline": "feature trim guide",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-23T23:33:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1f7e478534bfe982a7ea6cff0ea7326bc9d07dae",
"body": "minor updates",
"is_bot": false,
"headline": "Merge pull request #3 from Peltmonger/docs/publishing-flow",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-21T21:28:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3341e6bb962283fd10286659e758f79362d19e1f",
"body": null,
"is_bot": false,
"headline": "minor updates",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-21T21:27:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bce6973004317ae860b95bacbe80a24593adf398",
"body": null,
"is_bot": false,
"headline": "better llm docs",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-12T12:06:43Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "37a92b4859e46e0eb1295ed2818213b4baf805ac",
"body": null,
"is_bot": false,
"headline": "claude.md",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-12T12:04:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "338c28f8b4f63a5b323b9b9e3fbef6c3194fd818",
"body": "Making it a TS project",
"is_bot": false,
"headline": "Bump version from 1.0.2 to 1.1.0",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-12T11:57:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a0647ad74677cf60ad6af9672c2dbace79eb96a4",
"body": "Convert CLI to TypeScript with esbuild build step",
"is_bot": false,
"headline": "Merge pull request #1 from Peltmonger/worktree-ts-rewrite",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-12T11:56:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0dec6b93eada11d0c97e1f491d47c9c735ac8b38",
"body": null,
"is_bot": false,
"headline": "Fix script formatting in package.json",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-12T11:55:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d549fce98bb52190707d708ab2bc1378cd1372a6",
"body": "Splits the single bin/index.js into typed modules under src/ and bundles\nback to bin/index.js via esbuild. The published artifact is unchanged\nbehaviorally; bin/index.js is now generated and gitignored.\n\n- src/{index,logger,args,package-manager,project-name,release,scaffold,types}.ts\n- build.mjs: es\n[…]\njs\"]), engines >=18,\n scripts: build, typecheck, prepublishOnly\n- npm-publish workflow: npm ci + npm run build before npm publish\n\nCo-Authored-By: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
"is_bot": false,
"headline": "typescript rewrite with esbuild build",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-12T11:41:03Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "76ce4bc0dfe657459f93abbf63cd58d96df5eec1",
"body": null,
"is_bot": false,
"headline": "readme fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-04T20:00:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fb3355b797bf5393402d5adffdc74343160f3aa3",
"body": null,
"is_bot": false,
"headline": "v up",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-04T19:59:52Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b17f824dc49f82215b7285e4f48e76c82a1b573f",
"body": null,
"is_bot": false,
"headline": "no detached warning",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-04T19:58:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "eafcd678b45c58a4c2880f0c10d6c6b50f06840d",
"body": null,
"is_bot": false,
"headline": "slimer publish",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-04T19:43:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cfdc04a868ae7de18d8874ced9797b092e919af2",
"body": null,
"is_bot": false,
"headline": "smoother cli flow",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-04T19:41:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5c9673aa8b0e3af43c1d3e7903b81f695091a0b5",
"body": null,
"is_bot": false,
"headline": "fix script",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-04T19:29:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6447a5abff0c93312248b2548c5c004116481636",
"body": null,
"is_bot": false,
"headline": "readme fix",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-04T19:27:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6866c7e3cdc0151a36669b7d53fafe2587e67570",
"body": null,
"is_bot": false,
"headline": "initial version",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-06-04T19:23:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fb60441afd50dcf93a73da9e182a9a383ff613b7",
"body": "Updated Dependabot configuration to enable npm updates and changed schedule to monthly.",
"is_bot": false,
"headline": "Enable npm updates and change schedule to monthly",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-05-12T09:18:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b11a061c02b2c1d6f68ce8885179b4e797faeda6",
"body": null,
"is_bot": false,
"headline": "Initial commit",
"author_name": "Jens Kuerschner",
"author_login": "jekuer",
"committed_at": "2026-05-12T09:12:36Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 16,
"commits_last_year": 46,
"latest_release_at": "2026-07-17T10:30:31Z",
"latest_release_tag": "v1.4.1",
"releases_from_tags": false,
"days_since_last_push": 4,
"active_weeks_last_year": 8,
"days_since_latest_release": 4,
"mean_days_between_releases": 2.3
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 37,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "create-stardrive",
"exists": true,
"license": "MIT",
"keywords": [
"astro",
"stardrive",
"javascript",
"typescript",
"html",
"tailwind",
"web",
"landingpage",
"starter",
"template",
"framework",
"boilerplate"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/create-stardrive",
"is_deprecated": false,
"latest_version": "1.4.1",
"repository_url": "https://github.com/peltmonger/create-stardrive",
"versions_count": 16,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 1,
"monthly_downloads": 2190,
"first_published_at": "2026-06-04T19:33:13.337000Z",
"latest_published_at": "2026-07-17T10:30:43.470000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 4
}
]
},
"popularity": {
"forks": 1,
"stars": 1,
"watchers": 0,
"fork_history": {
"days": [
{
"date": "2026-07-10",
"count": 1
}
],
"complete": true,
"collected": 1,
"total_forks": 1
},
"star_history": {
"days": [
{
"date": "2026-07-10",
"count": 1
}
],
"complete": true,
"collected": 1,
"total_stars": 1
},
"open_issues_and_prs": 0
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [
"tsconfig.json"
],
"toolchain_manifests": [],
"largest_source_bytes": 13237,
"source_files_sampled": 10,
"oversized_source_files": 0,
"agent_instruction_files": [
"AGENTS.md",
"CLAUDE.md"
],
"agent_instruction_max_bytes": 4765
},
"dependencies": {
"manifests": [
"package.json"
],
"advisories": {
"error": null,
"scope": "repository_graph",
"source": "osv",
"findings": [],
"collected": true,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 30,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm"
],
"dependencies": [],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [
{
"name": "@esbuild/aix-ppc64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-arm",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/android-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/darwin-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/darwin-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/freebsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/freebsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-arm",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-ia32",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-loong64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-mips64el",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-ppc64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-riscv64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-s390x",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/linux-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/netbsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/netbsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openbsd-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openbsd-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/openharmony-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/sunos-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-arm64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-ia32",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@esbuild/win32-x64",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "@types/node",
"direct": false,
"version": "26.1.1",
"ecosystem": "npm"
},
{
"name": "esbuild",
"direct": false,
"version": "0.28.1",
"ecosystem": "npm"
},
{
"name": "typescript",
"direct": false,
"version": "6.0.3",
"ecosystem": "npm"
},
{
"name": "undici-types",
"direct": false,
"version": "8.3.0",
"ecosystem": "npm"
}
],
"collected": true,
"truncated": false,
"total_count": 30,
"direct_count": 0,
"indirect_count": 30
}
},
"maintainership": {
"issues": {
"open_prs": 0,
"merged_prs": 2,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 1
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "jekuer",
"commits": 46,
"avatar_url": "https://avatars.githubusercontent.com/u/8572883?v=4"
}
],
"contributors_sampled": 1,
"top_contributor_share": 1
},
"quality_signals": {
"has_ci": true,
"has_tests": false,
"ci_workflows": [
"npm-publish.yml"
],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 10,
"reason": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/29 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 0,
"reason": "project has 0 contributing companies or organizations -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 10,
"reason": "update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 0,
"reason": "project was created within the last 90 days. Please review its contents carefully",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 2,
"reason": "dependency not pinned by hash detected -- score normalized to 2",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 10,
"reason": "GitHub workflow tokens follow principle of least privilege",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "9ab75d463841582b7c98d5ae6fcd8e15b7ad1ac4",
"ran_at": "2026-07-22T09:23:54Z",
"aggregate_score": 5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": true
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-17T10:41:07Z",
"oldest_open_prs": [],
"last_merged_pr_at": "2026-06-21T21:28:08Z",
"ci_last_conclusion": "SUCCESS",
"oldest_open_issues": []
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/peltmonger/create-stardrive",
"host": "github.com",
"name": "create-stardrive",
"owner": "peltmonger"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 52,
"inputs": {
"security": 60,
"vitality": 74,
"community": 32,
"governance": 46,
"engineering": 46
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 74,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 56,
"inputs": {
"commits_last_year": 46,
"human_commit_share": 1,
"days_since_last_push": 4,
"active_weeks_last_year": 8
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "8/52 weeks with commits",
"points": 5.5,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 8
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "46 commits in the last year",
"points": 15,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 46
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "project was created within the last 90 days. Please review its contents carefully",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 100,
"inputs": {
"releases_count": 16,
"latest_release_tag": "v1.4.1",
"releases_from_tags": false,
"days_since_latest_release": 4,
"mean_days_between_releases": 2.3
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "16 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 16
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~2.3 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 2.3
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "repository_too_young",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 32,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"forks": 1,
"stars": 1,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "below_threshold"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "1 stars",
"points": 0,
"status": "missed",
"details": [
{
"code": "stars",
"params": {
"count": 1
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "1 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 1
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "moderate",
"name": "Community health",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "moderate",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 56,
"inputs": {
"packages": [
"create-stardrive"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 2190
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "2,190 downloads/month across npm",
"points": 44.5,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 2190,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "at_risk",
"name": "Sustainability & Governance",
"value": 46,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 10,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 1,
"top_contributor_share": 1
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 100% of commits",
"points": 0,
"status": "missed",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 100
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "1 contributors",
"points": 1.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 1
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "at_risk",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 48,
"inputs": {
"merged_prs": 2,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 1
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "2/3 decided PRs merged",
"points": 25.5,
"status": "partial",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 2,
"decided": 3
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/29 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "at_risk",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 44,
"inputs": {
"followers": 1,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "peltmonger",
"public_repos": 2,
"account_age_days": 1483
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "1 followers of peltmonger",
"points": 2.2,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 1,
"login": "peltmonger"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "2 public repos, account ~4 yr old",
"points": 11.6,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 2
}
},
{
"code": "account_age_years",
"params": {
"years": 4
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"create-stardrive"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 4
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 4 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 4
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "16 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 16
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "at_risk",
"name": "Engineering Quality",
"value": 46,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "at_risk",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 44,
"inputs": {
"has_ci": true,
"has_tests": false,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "1 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 1
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
"points": 20,
"status": "met",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"topics": [
"astro",
"astro-boilerplate",
"astro-starter",
"astro-template",
"astrojs",
"boilerplate",
"starter"
],
"has_wiki": false,
"homepage": null,
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "7 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 7
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "moderate",
"name": "Security",
"value": 60,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "moderate",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"packaging",
"signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 50,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/29 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 0 contributing companies or organizations -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "update tool detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "project was created within the last 90 days. Please review its contents carefully",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 2",
"points": 1,
"status": "partial",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "GitHub workflow tokens follow principle of least privilege",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "dependency_advisories",
"band": "excellent",
"name": "Dependency advisories",
"note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 30 resolved dependencies against OSV. This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"indirect_dependencies_free_of_known_advisories",
"no_advisories_left_outstanding"
]
}
},
{
"code": "weights_renormalized",
"params": {}
},
{
"code": "advisories_scope_repository",
"params": {
"assessed": 30
}
},
{
"code": "advisories_repo_graph_caveat",
"params": {}
},
{
"code": "advisories_reachability",
"params": {}
}
],
"value": 100,
"inputs": {
"source": "osv",
"advisories": 0,
"affected_packages": 0,
"assessed_packages": 30,
"unassessed_packages": 0,
"affected_by_severity": "none",
"direct_affected_packages": 0
},
"components": [
{
"key": "direct_dependencies_free_of_known_advisories",
"name": "Direct dependencies free of known advisories",
"detail": "no direct dependency carries a known advisory",
"points": 35,
"status": "met",
"details": [
{
"code": "no_direct_advisories",
"params": {}
}
],
"max_points": 35
},
{
"key": "indirect_dependencies_free_of_known_advisories",
"name": "Indirect dependencies free of known advisories",
"detail": "transitive set not separable from development and test dependencies in this scope",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_scope_not_separable",
"params": {}
}
],
"max_points": 25
},
{
"key": "no_advisories_left_outstanding",
"name": "No advisories left outstanding",
"detail": "no advisory carries a publication date",
"points": 0,
"status": "excluded",
"details": [
{
"code": "advisories_no_publication_date",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "malicious_dependencies",
"band": "excellent",
"name": "Malicious dependencies",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"source": "osv",
"meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
"packages": [],
"red_flag": false,
"assessed_packages": 30,
"malicious_packages": 0,
"direct_malicious_packages": 0,
"withdrawn_malicious_packages": 0,
"installable_malicious_packages": 0
},
"components": [
{
"key": "no_dependency_reported_as_a_malicious_package",
"name": "No dependency reported as a malicious package",
"detail": "no dependency is reported as a malicious package",
"points": 100,
"status": "met",
"details": [
{
"code": "no_malicious_dependencies",
"params": {}
}
],
"max_points": 100
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 2
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "moderate",
"name": "AI Readiness",
"value": 50,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "moderate",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.087,
"agent_instruction_files": [
"AGENTS.md",
"CLAUDE.md"
],
"agent_instruction_max_bytes": 4765
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "AGENTS.md, CLAUDE.md",
"points": 45,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "AGENTS.md, CLAUDE.md"
}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "4 of 46 human commits state their intent (structured subject or explanatory body)",
"points": 4.6,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 4,
"sampled": 46
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "at_risk",
"name": "Verify loop (build / test / typecheck)",
"note": null,
"notes": [],
"value": 32,
"inputs": {
"has_nix": false,
"has_tests": false,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": false,
"typed_language": true,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"tsconfig.json"
],
"agent_commit_share": 0.022,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "tsconfig.json",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "tsconfig.json"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "1 of the last 46 commits agent-authored or agent-credited",
"points": 4.3,
"status": "partial",
"details": [
{
"code": "agent_authored_commits",
"params": {
"count": 1,
"sampled": 46
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "dependency automation configured, none observed in the sampled commits",
"points": 5,
"status": "partial",
"details": [
{
"code": "dependency_bot_config_only",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 2",
"points": 2,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "excellent",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"primary_language": "TypeScript",
"largest_source_bytes": 13237,
"source_files_sampled": 10,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "TypeScript (statically typed)",
"points": 45,
"status": "met",
"details": [
{
"code": "statically_typed_language",
"params": {
"language": "TypeScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/10 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 10,
"oversized": 0
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"deps.dev does not index npm:create-stardrive@1.4.1; advisories assessed against the repository dependency graph instead"
],
"report_type": "repository",
"generated_at": "2026-07-22T09:24:00.880826Z",
"schema_version": "0.26.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/p/peltmonger/create-stardrive.svg",
"full_name": "peltmonger/create-stardrive",
"license_state": "standard",
"license_spdx": "MIT"
}Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.
Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.26.0 — повна методологія · вікі метрик.
Як окремий результат виглядає на тлі всього реєстру: сукупна статистика — npm.