Registro público
Informe de salud del softwareesquema 0.26.0 · métricas 1.13.0 · 2026-07-22 09:24 UTC

peltmonger / create-stardrive

Create a new top-notch astro boilerplate to kick of your next high-speed website. LLM-friendly.

TypeScriptMIT★ 1 estrella⑂ 1 forkdesde may 2026Ver en GitHub ↗

peltmonger/create-stardrive tiene un índice de salud de 52 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (74/100) y la más baja, Community & Adoption (32/100). Se actualizó por última vez hace 4 días. Una sola persona concentra la mayor parte del trabajo reciente.

52
global / 100
Moderado

Índice de salud del software

Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.

52
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
VitalidadComunidad yAdopciónSostenibilidady GobernanzaCalidad deIngenieríaSeguridadPreparaciónpara IA

Perfil de puntuación

Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.

Titularidad

PeltmongerOrganización
1 seguidor2 repositorios públicosdesde jun 2022

Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.

Ecosistemas de paquetes

RegistroPaqueteVersiónDescargas / mesVersionesÚltima publicaciónEtiquetas
npmcreate-stardrive1.4.1219016hace 4 díasastrostardrivejavascripttypescripthtmltailwindweblandingpagestartertemplateframeworkboilerplate

Métricas por categoría

Vitalidad

¿Está vivo el proyecto: se escribe código y se publican versiones?

74Bueno · 22% del índice global
Cómo se puntúa
36/36Recencia de push — último push hace 4 días
5.5/36Cadencia de commits — 8/52 semanas con commits
15/18Volumen de commits — 46 commits en el último año
0/10OpenSSF Scorecard: Maintained — project was created within the last 90 days. Please review its contents carefully
Datos de entrada utilizados
commits_last_year46
human_commit_share1
days_since_last_push4
active_weeks_last_year8
Cómo se puntúa
27/27Publica versiones — 16 versiones publicadas
36/36Recencia de las versiones — última versión hace 4 días
27/27Cadencia de publicación — una versión cada ~2,3 días
0/10OpenSSF Scorecard: Signed-Releases — sin datos
Datos de entrada utilizados
releases_count16
latest_release_tagv1.4.1
releases_from_tagsno
days_since_latest_release4
mean_days_between_releases2,3
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.

Comunidad y Adopción

¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?

32En riesgo · 18% del índice global
Cómo se puntúa
0/60Estrellas — 1 estrellas
0/25Forks — 1 forks
0/15Observadores — 0 observadores
Datos de entrada utilizados
forks1
stars1
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonbelow_threshold
Cómo se puntúa
22.5/22.5README
22.5/22.5Licencia — licencia reconocida (MIT)
0/18Guía CONTRIBUTING
0/13.5Código de conducta
0/7.2Plantilla de issues
0/6.3Plantilla de PR
Datos de entrada utilizados
has_readme
has_license
has_contributingno
has_issue_templateno
has_code_of_conductno
has_pull_request_templateno
Cómo se puntúa
44.5/80Descargas mensuales — 2190 descargas/mes en npm
0/20Dependientes en el registro — no lo informa este ecosistema
Datos de entrada utilizados
packagescreate-stardrive
dependents
ecosystemsnpm
total_downloads
monthly_downloads2190
Excluidos de la puntuación (sin datos o no aplicable): Dependientes en el registro. Los pesos restantes se han renormalizado.

Sostenibilidad y Gobernanza

¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?

46En riesgo · 24% del índice global
Cómo se puntúa
9/54Factor bus — la mitad de los commits recae en 1 contribuyente(s)
0/22.5Distribución de commits — el principal contribuyente firma el 100% de los commits
1.4/13.5Amplitud de contribuyentes — 1 contribuyentes
0/10OpenSSF Scorecard: Contributors — project has 0 contributing companies or organizations -- score normalized to 0
Datos de entrada utilizados
bus_factor1
contributors_sampled1
top_contributor_share1
Cómo se puntúa
0/46.8Resolución de issues — sin issues o sin datos
25.5/38.3Aceptación de PR — 2/3 PR decididos fusionados
0/15OpenSSF Scorecard: Code-Review — Found 0/29 approved changesets -- score normalized to 0
Datos de entrada utilizados
merged_prs2
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs1
Excluidos de la puntuación (sin datos o no aplicable): Resolución de issues. Los pesos restantes se han renormalizado.
Cómo se puntúa
30/30Respaldo de la propiedad — propiedad de una organización
0/20Dominio verificado
2.2/25Alcance del propietario — 1 seguidores de peltmonger
11.6/25Trayectoria — 2 repos públicos, cuenta de ~4 años
Datos de entrada utilizados
followers1
owner_typeOrganization
is_verified
owner_loginpeltmonger
public_repos2
account_age_days1483
Cómo se puntúa
25/25Publicado y resoluble — 1 paquete(s) en npm
35/35Recencia de publicación — última publicación hace 4 días
20/20Historial de versiones — 16 versiones en el registro
20/20No obsoleto — activo, ni obsoleto ni retirado
Datos de entrada utilizados
packagescreate-stardrive
ecosystemsnpm
any_deprecatedno
min_days_since_publish4

Calidad de Ingeniería

¿Existen unas prácticas mínimas de ingeniería y documentación?

46En riesgo · 20% del índice global
Cómo se puntúa
24/24Flujos de trabajo de CI — 1 flujo(s) de trabajo
0/24Pruebas presentes
0/16Configuración de linter
0/9.6Hooks de pre-commit
0/6.4.editorconfig
20/20OpenSSF Scorecard: CI-Tests — 1 out of 1 merged PRs checked by a CI test -- score normalized to 10
Datos de entrada utilizados
has_ci
has_testsno
has_editorconfigno
has_linter_configno
has_precommit_configno

Documentación

50Moderado
Cómo se puntúa
30/30README
0/25Directorio de documentación
0/15Sitio de documentación / página del proyecto
10/10Descripción del repositorio
10/10Topics — 7 topics
0/10Wiki
Datos de entrada utilizados
topicsastro, astro-boilerplate, astro-starter, astro-template, astrojs, boilerplate, starter
has_wikino
homepage
has_readme
has_docs_dirno
has_description

Seguridad

¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?

60Moderado · 16% del índice global
Cómo se puntúa
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
2.5/2.5CI-Tests — 1 out of 1 merged PRs checked by a CI test -- score normalized to 10
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/29 approved changesets -- score normalized to 0
0/2.5Contributors — project has 0 contributing companies or organizations -- score normalized to 0
10/10Dangerous-Workflow — no dangerous workflow patterns detected
7.5/7.5Dependency-Update-Tool — update tool detected
0/5Fuzzing — project is not fuzzed
2.5/2.5Licencia — license file detected
0/7.5Maintained — project was created within the last 90 days. Please review its contents carefully
0/5Packaging — sin datos
1/5Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — sin datos
7.5/7.5Token-Permissions — GitHub workflow tokens follow principle of least privilege
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Datos de entrada utilizados
sourceopenssf_scorecard
checks_evaluated16
scorecard_versionv5.5.0
checks_inconclusive2
scorecard_aggregate5
Excluidos de la puntuación (sin datos o no aplicable): packaging, signed_releases. Los pesos restantes se han renormalizado.
Cómo se puntúa
35/35Dependencias directas libres de avisos conocidos — ninguna dependencia directa tiene un aviso conocido
0/25Dependencias indirectas libres de avisos conocidos — el conjunto transitivo no es separable de las dependencias de desarrollo y prueba en este alcance
0/40Sin avisos pendientes — ningún aviso tiene fecha de publicación
Datos de entrada utilizados
sourceosv
advisories0
affected_packages0
assessed_packages30
unassessed_packages0
affected_by_severitynone
direct_affected_packages0
Excluidos de la puntuación (sin datos o no aplicable): Dependencias indirectas libres de avisos conocidos, Sin avisos pendientes. Los pesos restantes se han renormalizado. Se cotejaron 30 dependencias resueltas con OSV. Este repositorio no publica ningún paquete que el índice resuelva, por lo que se evaluó en su lugar el grafo de dependencias del repositorio. Ese grafo mezcla fijaciones de desarrollo y prueba con las dependencias distribuidas, de modo que solo se puntúan las dependencias declaradas en tiempo de ejecución; los hallazgos transitivos se informan como contexto y quedan excluidos de la puntuación. No se analiza la alcanzabilidad.

Preparación para IA

¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.

50Moderado · 0% del índice global
Cómo se puntúa
45/45Instrucciones para agentes — AGENTS.md, CLAUDE.md
0/15Documentación legible por máquinas (llms.txt)
4.6/40Historial de commits legible — 4 de 46 commits humanos declaran su intención (asunto estructurado o cuerpo explicativo)
Datos de entrada utilizados
has_llms_txtno
legible_history_share0,087
agent_instruction_filesAGENTS.md, CLAUDE.md
agent_instruction_max_bytes4765
Cómo se puntúa
0/18Arranque con un solo comando
0/22Pruebas automatizadas
0/11Configuración de lint / formato
11/11Verificación estática de tipos — tsconfig.json
10/10Entorno reproducible — lockfile
4.3/10Práctica demostrada con agentes — 1 de los últimos 46 commits con autoría o crédito de agente
5/8Mantenimiento automatizado — automatización de dependencias configurada, no observada en los commits muestreados
2/10OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 2
Datos de entrada utilizados
has_nixno
has_testsno
lockfilespackage-lock.json
has_dockerfileno
typed_language
bootstrap_files
has_devcontainerno
has_linter_configno
typecheck_configstsconfig.json
agent_commit_share0,022
toolchain_manifests
dependency_bot_commit_share0
Cómo se puntúa
45/45Código verificable por tipos — TypeScript (tipado estático)
55/55Tamaños de archivo manejables — 0/10 archivos fuente de más de 60 KB
Datos de entrada utilizados
primary_languageTypeScript
largest_source_bytes13.237
source_files_sampled10
oversized_source_files0

Datos clave

1estrellas de GitHub
1contribuidores
46commits en los últimos 12 meses
4días desde el último push
16versiones publicadas
1factor bus
0issues abiertas
npmecosistemas de paquetes

Advertencias de recopilación de datos

  • deps.dev does not index npm:create-stardrive@1.4.1; advisories assessed against the repository dependency graph instead

Más detalle

OpenSSF Scorecard 5.0 / 10
5.0agregado

Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).Scorecard v5.5.0 · 2026-07-22 09:23 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
10CI-Tests1 out of 1 merged PRs checked by a CI test -- score normalized to 10
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/29 approved changesets -- score normalized to 0
0Contributorsproject has 0 contributing companies or organizations -- score normalized to 0
10Dangerous-Workflowno dangerous workflow patterns detected
10Dependency-Update-Toolupdate tool detected
0Fuzzingproject is not fuzzed
10Licenselicense file detected
0Maintainedproject was created within the last 90 days. Please review its contents carefully
n/dPackagingpackaging workflow not detected
2Pinned-Dependenciesdependency not pinned by hash detected -- score normalized to 2
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
n/dSigned-Releasesno releases found
10Token-PermissionsGitHub workflow tokens follow principle of least privilege
10Vulnerabilities0 existing vulnerabilities detected
Todas las dependencias 30

Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 0 paquetes directos y 30 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.

RegistroPaqueteVersiónRelación
npm@esbuild/aix-ppc640.28.1indirecta
npm@esbuild/android-arm0.28.1indirecta
npm@esbuild/android-arm640.28.1indirecta
npm@esbuild/android-x640.28.1indirecta
npm@esbuild/darwin-arm640.28.1indirecta
npm@esbuild/darwin-x640.28.1indirecta
npm@esbuild/freebsd-arm640.28.1indirecta
npm@esbuild/freebsd-x640.28.1indirecta
npm@esbuild/linux-arm0.28.1indirecta
npm@esbuild/linux-arm640.28.1indirecta
npm@esbuild/linux-ia320.28.1indirecta
npm@esbuild/linux-loong640.28.1indirecta
npm@esbuild/linux-mips64el0.28.1indirecta
npm@esbuild/linux-ppc640.28.1indirecta
npm@esbuild/linux-riscv640.28.1indirecta
npm@esbuild/linux-s390x0.28.1indirecta
npm@esbuild/linux-x640.28.1indirecta
npm@esbuild/netbsd-arm640.28.1indirecta
npm@esbuild/netbsd-x640.28.1indirecta
npm@esbuild/openbsd-arm640.28.1indirecta
npm@esbuild/openbsd-x640.28.1indirecta
npm@esbuild/openharmony-arm640.28.1indirecta
npm@esbuild/sunos-x640.28.1indirecta
npm@esbuild/win32-arm640.28.1indirecta
npm@esbuild/win32-ia320.28.1indirecta
npm@esbuild/win32-x640.28.1indirecta
npm@types/node26.1.1indirecta
npmesbuild0.28.1indirecta
npmtypescript6.0.3indirecta
npmundici-types8.3.0indirecta
Avisos de dependencias 0

Este repositorio no publica ningún paquete que el índice resuelva, así que se evaluó su propio grafo de dependencias — 30 paquetes, que incluyen también fijaciones de desarrollo y prueba que nunca se distribuyen: 0 tienen avisos conocidos, de los cuales 0 son directas.

Ningún aviso conocido afecta a las dependencias evaluadas.

Un aviso significa que la versión registrada en el grafo de dependencias cae dentro del rango afectado de un aviso. No se analiza la alcanzabilidad, y el grafo incluye fijaciones de desarrollo y prueba: un hallazgo puede referirse al utillaje y no al software distribuido.

Informe JSON sin procesar legible por máquina
{
  "data": {
    "repo": {
      "topics": [
        "astro",
        "astro-boilerplate",
        "astro-starter",
        "astro-template",
        "astrojs",
        "boilerplate",
        "starter"
      ],
      "is_fork": false,
      "size_kb": 178,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "JavaScript": 350,
        "TypeScript": 25579
      },
      "pushed_at": "2026-07-17T10:39:54Z",
      "created_at": "2026-05-12T09:12:35Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-17T10:39:58Z",
      "description": "Create a new top-notch astro boilerplate to kick of your next high-speed website. LLM-friendly.",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": "MIT",
      "default_branch": "main",
      "license_spdx_raw": "MIT",
      "primary_language": "TypeScript",
      "significant_languages": [
        "TypeScript"
      ]
    },
    "owner": {
      "blog": "https://peltmonger.com",
      "name": "Peltmonger",
      "type": "Organization",
      "login": "peltmonger",
      "company": null,
      "location": "Germany",
      "followers": 1,
      "avatar_url": "https://avatars.githubusercontent.com/u/108459341?v=4",
      "created_at": "2022-06-30T09:05:48Z",
      "is_verified": null,
      "public_repos": 2,
      "account_age_days": 1483
    },
    "license": {
      "state": "standard",
      "spdx_id": "MIT",
      "raw_spdx": "MIT",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "v1.4.1",
          "kind": "patch",
          "published_at": "2026-07-17T10:30:31Z"
        },
        {
          "tag": "v1.4.0",
          "kind": "minor",
          "published_at": "2026-07-17T09:36:36Z"
        },
        {
          "tag": "v1.3.8",
          "kind": "patch",
          "published_at": "2026-07-15T08:25:51Z"
        },
        {
          "tag": "v1.3.7",
          "kind": "patch",
          "published_at": "2026-07-09T17:38:28Z"
        },
        {
          "tag": "v1.3.6",
          "kind": "patch",
          "published_at": "2026-07-09T09:56:20Z"
        },
        {
          "tag": "v1.3.5",
          "kind": "patch",
          "published_at": "2026-07-07T19:08:50Z"
        },
        {
          "tag": "v1.3.4",
          "kind": "patch",
          "published_at": "2026-07-07T18:48:32Z"
        },
        {
          "tag": "v1.3.3",
          "kind": "patch",
          "published_at": "2026-07-06T20:44:35Z"
        },
        {
          "tag": "v1.2.3",
          "kind": "patch",
          "published_at": "2026-06-26T23:35:42Z"
        },
        {
          "tag": "v1.2.2",
          "kind": "patch",
          "published_at": "2026-06-26T10:22:06Z"
        },
        {
          "tag": "v1.2.1",
          "kind": "patch",
          "published_at": "2026-06-24T11:39:43Z"
        },
        {
          "tag": "v1.2.0",
          "kind": "minor",
          "published_at": "2026-06-23T23:34:09Z"
        },
        {
          "tag": "v1.1.0",
          "kind": "minor",
          "published_at": "2026-06-12T11:57:44Z"
        },
        {
          "tag": "v1.0.2",
          "kind": "patch",
          "published_at": "2026-06-04T20:00:16Z"
        },
        {
          "tag": "v1.0.1",
          "kind": "patch",
          "published_at": "2026-06-04T19:45:35Z"
        },
        {
          "tag": "v1.0.0",
          "kind": "major",
          "published_at": "2026-06-04T19:30:28Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "9ab75d463841582b7c98d5ae6fcd8e15b7ad1ac4",
          "body": null,
          "is_bot": false,
          "headline": "one more line",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T10:39:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b2748dfe662bab9da021dd96e032b4058905b361",
          "body": null,
          "is_bot": false,
          "headline": "better blank line after removal handling; fixing droppedFeatures line",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T10:30:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7830e01e4be3b69777afd7a29f68401ed8ec40fa",
          "body": null,
          "is_bot": false,
          "headline": "droppedFeatures and better block removal",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-17T09:36:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "848be30079e4a5f47e844059ed7768cb434a4b28",
          "body": null,
          "is_bot": false,
          "headline": "optimizing gitignore and publish script",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:25:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "64a8f1526ff4cb512c8c712886cd4c78e35bbf3c",
          "body": null,
          "is_bot": false,
          "headline": "silencing install output",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:08:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ebef7c5e529c448fe2c380aa0bdb872ebaf58bdb",
          "body": null,
          "is_bot": false,
          "headline": "lower case optimization",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-15T08:05:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "642061bdaace3cad263d5a0ebebc142255a426a7",
          "body": null,
          "is_bot": false,
          "headline": "improving win compat",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-09T17:37:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f5b7a1598be628c78d112b74925cf833fa5db48",
          "body": null,
          "is_bot": false,
          "headline": "Fixing compatibility issues with Windows",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-09T09:41:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a508063fe088bae6bc34974b307df99c99d5c51",
          "body": null,
          "is_bot": false,
          "headline": "sponsoring option",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T19:56:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "277c0616fd04493c1a87dfc18f3bbfeece0016f3",
          "body": null,
          "is_bot": false,
          "headline": "Cloudflare fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T19:08:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7bcef54fc78a55e581622972859511289b3bc266",
          "body": null,
          "is_bot": false,
          "headline": "better cleanup with no features selected",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-07T18:47:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e75ed490c1a3fdf06b755578bdb17589e4853481",
          "body": null,
          "is_bot": false,
          "headline": "STARDRIVE_AGENT_MODE file fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-06T23:06:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "294b75cb2c89bd1c05ba0c4eea52cbd6eb41bb84",
          "body": null,
          "is_bot": false,
          "headline": "calibrating gitignore",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-06T20:43:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e3388f5384cb88ff58165032ae0b741d6f3710da",
          "body": null,
          "is_bot": false,
          "headline": "adjust to new component structure",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-02T18:45:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18b56ccaacae766b90db3316456906fc0ae56816",
          "body": null,
          "is_bot": false,
          "headline": "removing custom event sitemap",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T22:38:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "84c9ad3de31566b99e199fcae0d9041099e82475",
          "body": null,
          "is_bot": false,
          "headline": "adding event-bridge to be dropped in the event case",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T20:46:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "422f461d1fc3107c4fe47f229a45ba3d4e30415f",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T18:56:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9f4e29cc28b47debbc96f27bdcc737d665a71a9b",
          "body": null,
          "is_bot": false,
          "headline": "setAgentMode",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T08:00:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4e61ad459070858f7fce43d74e5238ce31704b40",
          "body": null,
          "is_bot": false,
          "headline": "faq fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-07-01T00:23:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "93ed13a55c65dc3814a312ecc76c28bb4afca52c",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T18:42:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f026327c9cf5377350501a890cb88ac4edcd4d3",
          "body": null,
          "is_bot": false,
          "headline": "fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T12:47:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7abc3f632918c8cfd002de04264aa91fed7ecb12",
          "body": null,
          "is_bot": false,
          "headline": "clean-up for events feature",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-29T11:39:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3a21c8335bff0bc547f07d626900c3cb4de37666",
          "body": null,
          "is_bot": false,
          "headline": "typo",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-28T13:59:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "58843603314626d27acfc987df23368a0eb18227",
          "body": null,
          "is_bot": false,
          "headline": "agents.md fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-28T13:55:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "51e837fc376dbec6f09186925f5541f8763459cf",
          "body": null,
          "is_bot": false,
          "headline": "minor fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-26T23:09:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f3a0f6e9961b8036993d67b52a7f8b2984c0bab5",
          "body": null,
          "is_bot": false,
          "headline": "also drop _redirects on CF disable",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-26T10:21:14Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ce22427d5c7534a95e776a34e7037ff55de62480",
          "body": null,
          "is_bot": false,
          "headline": "minor scaffold fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-24T11:24:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0301d2cb71c65530295059205638dcd8741b9d5e",
          "body": null,
          "is_bot": false,
          "headline": "feature trim guide",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-23T23:33:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1f7e478534bfe982a7ea6cff0ea7326bc9d07dae",
          "body": "minor updates",
          "is_bot": false,
          "headline": "Merge pull request #3 from Peltmonger/docs/publishing-flow",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-21T21:28:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3341e6bb962283fd10286659e758f79362d19e1f",
          "body": null,
          "is_bot": false,
          "headline": "minor updates",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-21T21:27:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bce6973004317ae860b95bacbe80a24593adf398",
          "body": null,
          "is_bot": false,
          "headline": "better llm docs",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T12:06:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "37a92b4859e46e0eb1295ed2818213b4baf805ac",
          "body": null,
          "is_bot": false,
          "headline": "claude.md",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T12:04:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "338c28f8b4f63a5b323b9b9e3fbef6c3194fd818",
          "body": "Making it a TS project",
          "is_bot": false,
          "headline": "Bump version from 1.0.2 to 1.1.0",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:57:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a0647ad74677cf60ad6af9672c2dbace79eb96a4",
          "body": "Convert CLI to TypeScript with esbuild build step",
          "is_bot": false,
          "headline": "Merge pull request #1 from Peltmonger/worktree-ts-rewrite",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:56:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0dec6b93eada11d0c97e1f491d47c9c735ac8b38",
          "body": null,
          "is_bot": false,
          "headline": "Fix script formatting in package.json",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:55:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d549fce98bb52190707d708ab2bc1378cd1372a6",
          "body": "Splits the single bin/index.js into typed modules under src/ and bundles\nback to bin/index.js via esbuild. The published artifact is unchanged\nbehaviorally; bin/index.js is now generated and gitignored.\n\n- src/{index,logger,args,package-manager,project-name,release,scaffold,types}.ts\n- build.mjs: es\n[…]\njs\"]), engines >=18,\n  scripts: build, typecheck, prepublishOnly\n- npm-publish workflow: npm ci + npm run build before npm publish\n\nCo-Authored-By: Claude Opus 4.7 (1M context) <noreply@anthropic.com>",
          "is_bot": false,
          "headline": "typescript rewrite with esbuild build",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-12T11:41:03Z",
          "body_truncated": true,
          "is_coding_agent": true
        },
        {
          "oid": "76ce4bc0dfe657459f93abbf63cd58d96df5eec1",
          "body": null,
          "is_bot": false,
          "headline": "readme fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T20:00:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fb3355b797bf5393402d5adffdc74343160f3aa3",
          "body": null,
          "is_bot": false,
          "headline": "v up",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:59:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b17f824dc49f82215b7285e4f48e76c82a1b573f",
          "body": null,
          "is_bot": false,
          "headline": "no detached warning",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:58:38Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "eafcd678b45c58a4c2880f0c10d6c6b50f06840d",
          "body": null,
          "is_bot": false,
          "headline": "slimer publish",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:43:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "cfdc04a868ae7de18d8874ced9797b092e919af2",
          "body": null,
          "is_bot": false,
          "headline": "smoother cli flow",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:41:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5c9673aa8b0e3af43c1d3e7903b81f695091a0b5",
          "body": null,
          "is_bot": false,
          "headline": "fix script",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:29:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6447a5abff0c93312248b2548c5c004116481636",
          "body": null,
          "is_bot": false,
          "headline": "readme fix",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:27:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6866c7e3cdc0151a36669b7d53fafe2587e67570",
          "body": null,
          "is_bot": false,
          "headline": "initial version",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-06-04T19:23:41Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fb60441afd50dcf93a73da9e182a9a383ff613b7",
          "body": "Updated Dependabot configuration to enable npm updates and changed schedule to monthly.",
          "is_bot": false,
          "headline": "Enable npm updates and change schedule to monthly",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-05-12T09:18:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b11a061c02b2c1d6f68ce8885179b4e797faeda6",
          "body": null,
          "is_bot": false,
          "headline": "Initial commit",
          "author_name": "Jens Kuerschner",
          "author_login": "jekuer",
          "committed_at": "2026-05-12T09:12:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 16,
      "commits_last_year": 46,
      "latest_release_at": "2026-07-17T10:30:31Z",
      "latest_release_tag": "v1.4.1",
      "releases_from_tags": false,
      "days_since_last_push": 4,
      "active_weeks_last_year": 8,
      "days_since_latest_release": 4,
      "mean_days_between_releases": 2.3
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "create-stardrive",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "astro",
            "stardrive",
            "javascript",
            "typescript",
            "html",
            "tailwind",
            "web",
            "landingpage",
            "starter",
            "template",
            "framework",
            "boilerplate"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/create-stardrive",
          "is_deprecated": false,
          "latest_version": "1.4.1",
          "repository_url": "https://github.com/peltmonger/create-stardrive",
          "versions_count": 16,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 1,
          "monthly_downloads": 2190,
          "first_published_at": "2026-06-04T19:33:13.337000Z",
          "latest_published_at": "2026-07-17T10:30:43.470000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 4
        }
      ]
    },
    "popularity": {
      "forks": 1,
      "stars": 1,
      "watchers": 0,
      "fork_history": {
        "days": [
          {
            "date": "2026-07-10",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_forks": 1
      },
      "star_history": {
        "days": [
          {
            "date": "2026-07-10",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_stars": 1
      },
      "open_issues_and_prs": 0
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "tsconfig.json"
      ],
      "toolchain_manifests": [],
      "largest_source_bytes": 13237,
      "source_files_sampled": 10,
      "oversized_source_files": 0,
      "agent_instruction_files": [
        "AGENTS.md",
        "CLAUDE.md"
      ],
      "agent_instruction_max_bytes": 4765
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": "repository_graph",
        "source": "osv",
        "findings": [],
        "collected": true,
        "malicious": [],
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 30,
        "malicious_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [
          {
            "name": "@esbuild/aix-ppc64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-arm",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/android-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/darwin-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/darwin-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/freebsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/freebsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-arm",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-ia32",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-loong64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-mips64el",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-ppc64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-riscv64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-s390x",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/linux-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/netbsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/netbsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openbsd-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openbsd-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/openharmony-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/sunos-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-arm64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-ia32",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@esbuild/win32-x64",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "@types/node",
            "direct": false,
            "version": "26.1.1",
            "ecosystem": "npm"
          },
          {
            "name": "esbuild",
            "direct": false,
            "version": "0.28.1",
            "ecosystem": "npm"
          },
          {
            "name": "typescript",
            "direct": false,
            "version": "6.0.3",
            "ecosystem": "npm"
          },
          {
            "name": "undici-types",
            "direct": false,
            "version": "8.3.0",
            "ecosystem": "npm"
          }
        ],
        "collected": true,
        "truncated": false,
        "total_count": 30,
        "direct_count": 0,
        "indirect_count": 30
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 0,
        "merged_prs": 2,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 1
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "jekuer",
          "commits": 46,
          "avatar_url": "https://avatars.githubusercontent.com/u/8572883?v=4"
        }
      ],
      "contributors_sampled": 1,
      "top_contributor_share": 1
    },
    "quality_signals": {
      "has_ci": true,
      "has_tests": false,
      "ci_workflows": [
        "npm-publish.yml"
      ],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [
        "package-lock.json"
      ],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 10,
            "reason": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/29 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 0,
            "reason": "project has 0 contributing companies or organizations -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": 10,
            "reason": "no dangerous workflow patterns detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 10,
            "reason": "update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 10,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 0,
            "reason": "project was created within the last 90 days. Please review its contents carefully",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": 2,
            "reason": "dependency not pinned by hash detected -- score normalized to 2",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": 10,
            "reason": "GitHub workflow tokens follow principle of least privilege",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "9ab75d463841582b7c98d5ae6fcd8e15b7ad1ac4",
        "ran_at": "2026-07-22T09:23:54Z",
        "aggregate_score": 5,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": true
    },
    "contribution_flow": {
      "collected": true,
      "ci_last_run_at": "2026-07-17T10:41:07Z",
      "oldest_open_prs": [],
      "last_merged_pr_at": "2026-06-21T21:28:08Z",
      "ci_last_conclusion": "SUCCESS",
      "oldest_open_issues": []
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/peltmonger/create-stardrive",
    "host": "github.com",
    "name": "create-stardrive",
    "owner": "peltmonger"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "moderate",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 52,
      "inputs": {
        "security": 60,
        "vitality": 74,
        "community": 32,
        "governance": 46,
        "engineering": 46
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 74,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 56,
            "inputs": {
              "commits_last_year": 46,
              "human_commit_share": 1,
              "days_since_last_push": 4,
              "active_weeks_last_year": 8
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "8/52 weeks with commits",
                "points": 5.5,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 8
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "46 commits in the last year",
                "points": 15,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 46
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "project was created within the last 90 days. Please review its contents carefully",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "releases_count": 16,
              "latest_release_tag": "v1.4.1",
              "releases_from_tags": false,
              "days_since_latest_release": 4,
              "mean_days_between_releases": 2.3
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "16 releases published",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "releases_published",
                    "params": {
                      "count": 16
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~2.3 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 2.3
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "at_risk",
        "name": "Community & Adoption",
        "value": 32,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 1,
              "stars": 1,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "below_threshold"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "1 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "1 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "moderate",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "recognized license (MIT)",
                "points": 22.5,
                "status": "met",
                "details": [
                  {
                    "code": "license_standard",
                    "params": {}
                  },
                  {
                    "code": "license_spdx",
                    "params": {
                      "spdx": "MIT"
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "moderate",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 56,
            "inputs": {
              "packages": [
                "create-stardrive"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 2190
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "2,190 downloads/month across npm",
                "points": 44.5,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 2190,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 46,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 10,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 1,
              "top_contributor_share": 1
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 100% of commits",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 100
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "1 contributors",
                "points": 1.4,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "at_risk",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 48,
            "inputs": {
              "merged_prs": 2,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 1
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "2/3 decided PRs merged",
                "points": 25.5,
                "status": "partial",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 2,
                      "decided": 3
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/29 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "at_risk",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "followers": 1,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "peltmonger",
              "public_repos": 2,
              "account_age_days": 1483
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "1 followers of peltmonger",
                "points": 2.2,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 1,
                      "login": "peltmonger"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "2 public repos, account ~4 yr old",
                "points": 11.6,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 2
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 4
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "create-stardrive"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 4
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 4 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "16 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 16
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "at_risk",
        "name": "Engineering Quality",
        "value": 46,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "at_risk",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "has_ci": true,
              "has_tests": false,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": "1 workflow(s)",
                "points": 24,
                "status": "met",
                "details": [
                  {
                    "code": "ci_workflows",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
                "points": 20,
                "status": "met",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "astro",
                "astro-boilerplate",
                "astro-starter",
                "astro-template",
                "astrojs",
                "boilerplate",
                "starter"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "7 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 7
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "moderate",
        "name": "Security",
        "value": 60,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "moderate",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Packaging, Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "packaging",
                    "signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 50,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 16,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 2,
              "scorecard_aggregate": 5
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "1 out of 1 merged PRs checked by a CI test -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/29 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 0 contributing companies or organizations -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no dangerous workflow patterns detected",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "update tool detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "project was created within the last 90 days. Please review its contents carefully",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 2",
                "points": 1,
                "status": "partial",
                "details": [],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "GitHub workflow tokens follow principle of least privilege",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "dependency_advisories",
            "band": "excellent",
            "name": "Dependency advisories",
            "note": "Excluded from scoring (no data or not applicable): Indirect dependencies free of known advisories, No advisories left outstanding. Remaining weights renormalized. Matched 30 resolved dependencies against OSV. This repository publishes no package the index resolves, so the repository dependency graph was assessed instead. That graph mixes development and test pins with shipped dependencies, so only the declared runtime dependencies are scored; transitive findings are reported as context and excluded from the score. Reachability is not analyzed.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "indirect_dependencies_free_of_known_advisories",
                    "no_advisories_left_outstanding"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              },
              {
                "code": "advisories_scope_repository",
                "params": {
                  "assessed": 30
                }
              },
              {
                "code": "advisories_repo_graph_caveat",
                "params": {}
              },
              {
                "code": "advisories_reachability",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "source": "osv",
              "advisories": 0,
              "affected_packages": 0,
              "assessed_packages": 30,
              "unassessed_packages": 0,
              "affected_by_severity": "none",
              "direct_affected_packages": 0
            },
            "components": [
              {
                "key": "direct_dependencies_free_of_known_advisories",
                "name": "Direct dependencies free of known advisories",
                "detail": "no direct dependency carries a known advisory",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "no_direct_advisories",
                    "params": {}
                  }
                ],
                "max_points": 35
              },
              {
                "key": "indirect_dependencies_free_of_known_advisories",
                "name": "Indirect dependencies free of known advisories",
                "detail": "transitive set not separable from development and test dependencies in this scope",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_scope_not_separable",
                    "params": {}
                  }
                ],
                "max_points": 25
              },
              {
                "key": "no_advisories_left_outstanding",
                "name": "No advisories left outstanding",
                "detail": "no advisory carries a publication date",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "advisories_no_publication_date",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "malicious_dependencies",
            "band": "excellent",
            "name": "Malicious dependencies",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "source": "osv",
              "meaning": "reported as a malicious package by the OpenSSF corpus; the remedy is removal or moving off the compromised name, never an upgrade of the same artifact. Versions the registry has since pulled are listed but not scored",
              "packages": [],
              "red_flag": false,
              "assessed_packages": 30,
              "malicious_packages": 0,
              "direct_malicious_packages": 0,
              "withdrawn_malicious_packages": 0,
              "installable_malicious_packages": 0
            },
            "components": [
              {
                "key": "no_dependency_reported_as_a_malicious_package",
                "name": "No dependency reported as a malicious package",
                "detail": "no dependency is reported as a malicious package",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "no_malicious_dependencies",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 2
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "moderate",
        "name": "AI Readiness",
        "value": 50,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "moderate",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0.087,
              "agent_instruction_files": [
                "AGENTS.md",
                "CLAUDE.md"
              ],
              "agent_instruction_max_bytes": 4765
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "AGENTS.md, CLAUDE.md",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "AGENTS.md, CLAUDE.md"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "4 of 46 human commits state their intent (structured subject or explanatory body)",
                "points": 4.6,
                "status": "partial",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 4,
                      "sampled": 46
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "at_risk",
            "name": "Verify loop (build / test / typecheck)",
            "note": null,
            "notes": [],
            "value": 32,
            "inputs": {
              "has_nix": false,
              "has_tests": false,
              "lockfiles": [
                "package-lock.json"
              ],
              "has_dockerfile": false,
              "typed_language": true,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [
                "tsconfig.json"
              ],
              "agent_commit_share": 0.022,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "lockfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "lockfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "1 of the last 46 commits agent-authored or agent-credited",
                "points": 4.3,
                "status": "partial",
                "details": [
                  {
                    "code": "agent_authored_commits",
                    "params": {
                      "count": 1,
                      "sampled": 46
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "dependency automation configured, none observed in the sampled commits",
                "points": 5,
                "status": "partial",
                "details": [
                  {
                    "code": "dependency_bot_config_only",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "dependency not pinned by hash detected -- score normalized to 2",
                "points": 2,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "excellent",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "primary_language": "TypeScript",
              "largest_source_bytes": 13237,
              "source_files_sampled": 10,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "TypeScript (statically typed)",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "TypeScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/10 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 10,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "deps.dev does not index npm:create-stardrive@1.4.1; advisories assessed against the repository dependency graph instead"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-22T09:24:00.880826Z",
  "schema_version": "0.26.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/p/peltmonger/create-stardrive.svg",
  "full_name": "peltmonger/create-stardrive",
  "license_state": "standard",
  "license_spdx": "MIT"
}

Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.

Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.26.0 — metodología completa · wiki de métricas.

Cómo se sitúa un resultado dentro del registro general: estadísticas agregadasnpm.