Public recordAt risk
Software health reportschema 0.23.0 · metrics 1.13.0 · 2026-07-21 20:25 UTC
tinymce / tinymce-dist
Official TinyMCE repository for production usage in package managers
tinymce/tinymce-dist holds a health index of 48 out of 100, placing it in the At risk band. It scores highest on Vitality (74/100) and lowest on AI Readiness (10/100). It was last updated 6 days ago. A single contributor accounts for most of its recent work.
48
overall / 100Software health index
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At risk ceiling of 49. AI Readiness sits outside the overall score.
48
Excellent85-100Exemplary; meets essentially all checked criteria
Good70-84Healthy; minor gaps
Moderate50-69Acceptable with notable gaps; review recommended
At risk30-49Significant weaknesses; adoption warrants caution
Critical1-29Severe problems (abandoned, single-maintainer, no hygiene)
Score profile
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
Ownership
TinyOrganization
418 followers102 public repossince Aug 2009
This repository is backed by an organization — shared, accountable stewardship that can outlive any single maintainer.
Package ecosystems
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | tinymcepoints to another repo — not scored | 8.8.0 | 4,489,241 | 218 | 6 days ago | wysiwygtinymcerichtextjavascripthtmltextrich-editorrich-text-editorrterich-textcontenteditableediting |
| Packagist | tinymce/tinymce | 8.8.0 | 173,352 | 243 | 6 days ago | textjavascriptwysiwygtinymcehtmleditingrichtextcontenteditablerterich-editorrich-text-editorrich-text |
Metrics by category
Vitality
Is the project alive — is code being written and are releases shipping?
74
Development activity
64Moderate
How it's scored
| 36/36 | Push recency — last push 6 days ago |
| 11.1/36 | Commit cadence — 16/52 weeks with commits |
| 11.9/18 | Commit volume — 20 commits in the last year |
| 5/10 | OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
Inputs used
| commits_last_year | 20 |
| human_commit_share | 1 |
| days_since_last_push | 6 |
| active_weeks_last_year | 16 |
Release discipline
88Excellent
How it's scored
| 16.2/27 | Ships releases — 100 version tags (no GitHub releases) |
| 36/36 | Release recency — latest release 6 days ago |
| 27/27 | Release cadence — a release every ~26.7 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — no data |
Inputs used
| releases_count | 100 |
| latest_release_tag | 8.8.0 |
| releases_from_tags | yes |
| days_since_latest_release | 6 |
| mean_days_between_releases | 26.7 |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.
Community & Adoption
Does the project have users, downloads, attention, and a welcoming setup for contributors?
61
Popularity & adoption
62Moderate
How it's scored
| 36.1/60 | Stars — 170 stars |
| 18.3/25 | Forks — 158 forks |
| 7.6/15 | Watchers — 24 watchers |
Inputs used
| forks | 158 |
| stars | 170 |
| watchers | 24 |
| growth_state | organic |
| growth_factor_pct | 100 |
Community health
44At risk
How it's scored
| 22.5/22.5 | README |
| 16.9/22.5 | License — license file present, not a recognized license |
| 0/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
Inputs used
| has_readme | yes |
| has_license | yes |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
How it's scored
| 69.9/80 | Monthly downloads — 173,352 downloads/month across packagist |
| 13.8/20 | Registry dependents — 115 packages depend on it |
Inputs used
| packages | tinymce/tinymce |
| dependents | 115 |
| ecosystems | packagist |
| total_downloads | 8,167,016 |
| monthly_downloads | 173,352 |
Sustainability & Governance
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
45
Maintainer resilience (bus factor)
22Critical
How it's scored
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0.3/22.5 | Commit distribution — top contributor authored 99% of commits |
| 2.7/13.5 | Contributor breadth — 2 contributors |
| 10/10 | OpenSSF Scorecard: Contributors — project has 3 contributing companies or organizations -- score normalized to 10 |
Inputs used
| bus_factor | 1 |
| contributors_sampled | 2 |
| top_contributor_share | 0.987 |
Issue & PR responsiveness
1Critical
How it's scored
| 0/46.8 | Issue resolution — no issues or no data |
| 0/38.3 | PR acceptance — 0/12 decided PRs merged |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Inputs used
| merged_prs | 0 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 12 |
Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.
Ownership & stewardship
74Good
How it's scored
| 30/30 | Ownership backing — organization-owned |
| 0/20 | Verified domain |
| 18.9/25 | Owner reach — 418 followers of tinymce |
| 25/25 | Track record — 102 public repos, account ~16 yr old |
Inputs used
| followers | 418 |
| owner_type | Organization |
| is_verified | — |
| owner_login | tinymce |
| public_repos | 102 |
| account_age_days | 6,173 |
Package maintenance
100Excellent
How it's scored
| 25/25 | Published & resolvable — 1 package(s) on packagist |
| 35/35 | Publish recency — latest publish 6 days ago |
| 20/20 | Version history — 243 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
Inputs used
| packages | tinymce/tinymce |
| ecosystems | packagist |
| any_deprecated | no |
| min_days_since_publish | 6 |
Engineering Quality
Are baseline engineering and documentation practices in place?
21
Engineering practices
1Critical
How it's scored
| 0/24 | CI workflows |
| 0/24 | Tests present |
| 0/16 | Linter config |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
Inputs used
| has_ci | no |
| has_tests | no |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.
Documentation
50Moderate
How it's scored
| 30/30 | README |
| 0/25 | Documentation directory |
| 0/15 | Documentation / homepage site |
| 10/10 | Repository description |
| 10/10 | Topics — 1 topics |
| 0/10 | Wiki |
Inputs used
| topics | tinymce |
| has_wiki | no |
| homepage | — |
| has_readme | yes |
| has_docs_dir | no |
| has_description | yes |
Security
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
35
Security posture
35At risk
How it's scored
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 3 contributing companies or organizations -- score normalized to 10 |
| 0/10 | Dangerous-Workflow — no data |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.2/2.5 | License — license file detected |
| 3.8/7.5 | Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| 0/5 | Packaging — no data |
| 0/5 | Pinned-Dependencies — no data |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — no data |
| 0/7.5 | Token-Permissions — no data |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Inputs used
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 3.5 |
Excluded from scoring (no data or not applicable): ci_tests, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Remaining weights renormalized.
AI Readiness
How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score.
10
Agent context & guidance
1Critical
How it's scored
| 0/45 | Agent instructions — no CLAUDE.md / AGENTS.md / editor rules |
| 0/15 | Machine-readable docs (llms.txt) |
| 0/40 | Legible commit history — 0 of 100 human commits state their intent (structured subject or explanatory body) |
Inputs used
| has_llms_txt | no |
| legible_history_share | 0 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
How it's scored
| 0/18 | One-command bootstrap |
| 0/22 | Automated tests |
| 0/11 | Lint / format config |
| 0/11 | Static type checking |
| 0/10 | Reproducible environment |
| 0/10 | Demonstrated agent practice — no agent-authored commits among the last 100 |
| 0/8 | Automated maintenance — no automated dependency updates observed |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — no data |
Inputs used
| has_nix | no |
| has_tests | no |
| lockfiles | — |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.
Code legibility for models
50Moderate
How it's scored
| 0/45 | Type-checkable code — JavaScript without a type-check config |
| 49.5/55 | Manageable file sizes — 22/221 source files over 60KB |
Inputs used
| primary_language | JavaScript |
| largest_source_bytes | 1,895,997 |
| source_files_sampled | 221 |
| oversized_source_files | 22 |
Key facts
170GitHub stars
2contributors
20commits, last 12 months
6days since last push
100releases
1bus factor
0open issues
npm, Packagistpackage ecosystems
Data collection warnings
- npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring
- deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead
More detail
Star and fork history 170 ★ / 158 ⇿
170Stars
158Forks
98Releases
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Major 3Minor 30Patch 65
Each point covers 12 days.
OpenSSF Scorecard 3.5 / 10
3.5aggregate
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 3 contributing companies or organizations -- score normalized to 10 |
| n/a | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 9 | License | license file detected |
| 5 | Maintained | 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| n/a | Packaging | packaging workflow not detected |
| n/a | Pinned-Dependencies | no dependencies found |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| n/a | Signed-Releases | no releases found |
| n/a | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
All dependencies 0
Full resolved dependency set from the GitHub dependency graph: 0 direct and 0 indirect (transitive) packages. The transitive closure is complete when the repository commits a lockfile.
| Registry | Package | Version | Relation |
|---|
Dependency advisories not assessed
Advisory matching could not run for this report: No resolved dependencies to assess
Raw JSON report machine-readable
{
"data": {
"repo": {
"topics": [
"tinymce"
],
"is_fork": false,
"size_kb": 51419,
"has_wiki": false,
"homepage": null,
"languages": {
"CSS": 1221547,
"JavaScript": 5155732,
"TypeScript": 270304
},
"pushed_at": "2026-07-15T02:36:44Z",
"created_at": "2014-05-06T10:57:12Z",
"owner_type": "Organization",
"updated_at": "2026-07-15T02:36:49Z",
"description": "Official TinyMCE repository for production usage in package managers",
"is_archived": false,
"is_disabled": false,
"license_spdx": null,
"default_branch": "master",
"license_spdx_raw": "NOASSERTION",
"primary_language": "JavaScript",
"significant_languages": [
"JavaScript",
"CSS"
]
},
"owner": {
"blog": "https://www.tiny.cloud/",
"name": "Tiny",
"type": "Organization",
"login": "tinymce",
"company": null,
"location": null,
"followers": 418,
"avatar_url": "https://avatars.githubusercontent.com/u/119815?v=4",
"created_at": "2009-08-26T18:15:21Z",
"is_verified": null,
"public_repos": 102,
"account_age_days": 6173
},
"license": {
"state": "custom",
"spdx_id": null,
"raw_spdx": "NOASSERTION",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "8.8.0",
"kind": "minor",
"published_at": "2026-07-15T02:36:42Z"
},
{
"tag": "8.7.0",
"kind": "minor",
"published_at": "2026-07-01T03:39:33Z"
},
{
"tag": "8.6.0",
"kind": "minor",
"published_at": "2026-06-03T03:28:15Z"
},
{
"tag": "8.5.1",
"kind": "patch",
"published_at": "2026-05-19T23:39:20Z"
},
{
"tag": "8.5.0",
"kind": "minor",
"published_at": "2026-04-29T05:18:45Z"
},
{
"tag": "8.4.0",
"kind": "minor",
"published_at": "2026-03-31T06:07:53Z"
},
{
"tag": "8.3.2",
"kind": "patch",
"published_at": "2026-01-14T01:01:47Z"
},
{
"tag": "8.3.1",
"kind": "patch",
"published_at": "2025-12-17T00:53:22Z"
},
{
"tag": "8.3.0",
"kind": "minor",
"published_at": "2025-12-10T01:56:11Z"
},
{
"tag": "8.2.2",
"kind": "patch",
"published_at": "2025-11-17T03:22:11Z"
},
{
"tag": "8.2.1",
"kind": "patch",
"published_at": "2025-11-06T00:55:35Z"
},
{
"tag": "8.2.0",
"kind": "minor",
"published_at": "2025-10-23T01:11:24Z"
},
{
"tag": "8.1.2",
"kind": "patch",
"published_at": "2025-09-18T08:46:07Z"
},
{
"tag": "8.1.1",
"kind": "patch",
"published_at": "2025-09-17T15:22:02Z"
},
{
"tag": "8.1.0",
"kind": "minor",
"published_at": "2025-09-17T04:18:06Z"
},
{
"tag": "8.0.2",
"kind": "patch",
"published_at": "2025-08-14T02:39:07Z"
},
{
"tag": "8.0.1",
"kind": "patch",
"published_at": "2025-07-28T04:53:13Z"
},
{
"tag": "8.0.0",
"kind": "major",
"published_at": "2025-07-23T02:30:15Z"
},
{
"tag": "7.9.3",
"kind": "patch",
"published_at": "2026-05-19T23:38:56Z"
},
{
"tag": "7.9.2",
"kind": "patch",
"published_at": "2026-02-11T03:44:54Z"
},
{
"tag": "7.9.1",
"kind": "patch",
"published_at": "2025-05-29T02:22:36Z"
},
{
"tag": "7.9.0",
"kind": "minor",
"published_at": "2025-05-15T01:47:37Z"
},
{
"tag": "7.8.0",
"kind": "minor",
"published_at": "2025-04-09T02:06:27Z"
},
{
"tag": "7.7.2",
"kind": "patch",
"published_at": "2025-03-19T03:36:58Z"
},
{
"tag": "7.7.1",
"kind": "patch",
"published_at": "2025-03-05T00:36:32Z"
},
{
"tag": "7.7.0",
"kind": "minor",
"published_at": "2025-02-20T08:31:02Z"
},
{
"tag": "7.6.1",
"kind": "patch",
"published_at": "2025-01-22T03:57:00Z"
},
{
"tag": "7.6.0",
"kind": "minor",
"published_at": "2024-12-11T04:56:37Z"
},
{
"tag": "7.5.1",
"kind": "patch",
"published_at": "2024-11-13T03:16:27Z"
},
{
"tag": "7.5.0",
"kind": "minor",
"published_at": "2024-11-06T03:04:46Z"
},
{
"tag": "7.4.1",
"kind": "patch",
"published_at": "2024-10-10T05:50:45Z"
},
{
"tag": "7.4.0",
"kind": "minor",
"published_at": "2024-10-09T05:28:03Z"
},
{
"tag": "7.3.0",
"kind": "minor",
"published_at": "2024-08-07T06:30:33Z"
},
{
"tag": "7.2.1",
"kind": "patch",
"published_at": "2024-07-03T05:25:26Z"
},
{
"tag": "7.2.0",
"kind": "minor",
"published_at": "2024-06-19T06:08:58Z"
},
{
"tag": "7.1.2",
"kind": "patch",
"published_at": "2024-06-05T05:16:22Z"
},
{
"tag": "7.1.1",
"kind": "patch",
"published_at": "2024-05-22T08:18:50Z"
},
{
"tag": "7.1.0",
"kind": "minor",
"published_at": "2024-05-08T05:24:56Z"
},
{
"tag": "7.0.1",
"kind": "patch",
"published_at": "2024-04-10T07:29:34Z"
},
{
"tag": "7.0.0",
"kind": "major",
"published_at": "2024-03-20T05:46:56Z"
},
{
"tag": "6.8.6",
"kind": "patch",
"published_at": "2025-05-29T02:36:52Z"
},
{
"tag": "6.8.5",
"kind": "patch",
"published_at": "2024-10-10T06:06:02Z"
},
{
"tag": "6.8.4",
"kind": "patch",
"published_at": "2024-06-19T09:28:48Z"
},
{
"tag": "6.8.3",
"kind": "patch",
"published_at": "2024-02-08T23:33:30Z"
},
{
"tag": "6.8.2",
"kind": "patch",
"published_at": "2023-12-11T03:21:56Z"
},
{
"tag": "6.8.1",
"kind": "patch",
"published_at": "2023-11-29T09:44:11Z"
},
{
"tag": "6.8.0",
"kind": "minor",
"published_at": "2023-11-22T11:14:25Z"
},
{
"tag": "6.7.3",
"kind": "patch",
"published_at": "2023-11-15T00:41:51Z"
},
{
"tag": "6.7.2",
"kind": "patch",
"published_at": "2023-10-25T06:42:18Z"
},
{
"tag": "6.7.1",
"kind": "patch",
"published_at": "2023-10-19T03:04:57Z"
},
{
"tag": "6.7.0",
"kind": "minor",
"published_at": "2023-08-30T11:10:35Z"
},
{
"tag": "6.6.2",
"kind": "patch",
"published_at": "2023-08-09T04:58:32Z"
},
{
"tag": "6.6.1",
"kind": "patch",
"published_at": "2023-08-02T05:17:12Z"
},
{
"tag": "6.6.0",
"kind": "minor",
"published_at": "2023-07-12T06:32:00Z"
},
{
"tag": "6.5.1",
"kind": "patch",
"published_at": "2023-06-19T04:36:46Z"
},
{
"tag": "6.5.0",
"kind": "minor",
"published_at": "2023-06-13T00:10:53Z"
},
{
"tag": "6.4.2",
"kind": "patch",
"published_at": "2023-04-26T10:48:15Z"
},
{
"tag": "6.4.1",
"kind": "patch",
"published_at": "2023-03-29T01:33:40Z"
},
{
"tag": "6.4.0",
"kind": "minor",
"published_at": "2023-03-16T00:43:05Z"
},
{
"tag": "6.3.2",
"kind": "patch",
"published_at": "2023-02-22T07:52:19Z"
},
{
"tag": "6.3.1",
"kind": "patch",
"published_at": "2022-12-06T02:19:08Z"
},
{
"tag": "6.3.0",
"kind": "minor",
"published_at": "2022-11-23T02:47:17Z"
},
{
"tag": "6.2.0",
"kind": "minor",
"published_at": "2022-09-08T04:15:30Z"
},
{
"tag": "6.1.2",
"kind": "patch",
"published_at": "2022-07-29T00:24:40Z"
},
{
"tag": "6.1.1",
"kind": "patch",
"published_at": "2022-07-27T03:47:09Z"
},
{
"tag": "6.1.0",
"kind": "minor",
"published_at": "2022-06-29T05:36:09Z"
},
{
"tag": "6.0.3",
"kind": "patch",
"published_at": "2022-05-25T04:10:33Z"
},
{
"tag": "6.0.2",
"kind": "patch",
"published_at": "2022-04-27T03:41:08Z"
},
{
"tag": "6.0.1",
"kind": "patch",
"published_at": "2022-03-23T02:04:52Z"
},
{
"tag": "6.0.0",
"kind": "major",
"published_at": "2022-03-03T04:28:36Z"
},
{
"tag": "5.10.9",
"kind": "patch",
"published_at": "2023-11-15T00:42:08Z"
},
{
"tag": "5.10.8",
"kind": "patch",
"published_at": "2023-10-19T03:02:47Z"
},
{
"tag": "5.10.7",
"kind": "patch",
"published_at": "2022-12-07T03:50:54Z"
},
{
"tag": "5.10.6",
"kind": "patch",
"published_at": "2022-10-19T02:16:29Z"
},
{
"tag": "5.10.5",
"kind": "patch",
"published_at": "2022-05-25T04:08:16Z"
},
{
"tag": "5.10.4",
"kind": "patch",
"published_at": "2022-04-27T03:39:26Z"
},
{
"tag": "5.10.3",
"kind": "patch",
"published_at": "2022-02-09T03:24:06Z"
},
{
"tag": "5.10.2",
"kind": "patch",
"published_at": "2021-11-17T04:34:27Z"
},
{
"tag": "5.10.1",
"kind": "patch",
"published_at": "2021-11-03T03:57:12Z"
},
{
"tag": "5.10.0",
"kind": "minor",
"published_at": "2021-10-11T03:18:15Z"
},
{
"tag": "5.9.2",
"kind": "patch",
"published_at": "2021-09-08T03:45:09Z"
},
{
"tag": "5.9.1",
"kind": "patch",
"published_at": "2021-08-27T04:39:18Z"
},
{
"tag": "5.9.0",
"kind": "minor",
"published_at": "2021-08-26T05:43:13Z"
},
{
"tag": "5.8.2",
"kind": "patch",
"published_at": "2021-06-23T06:52:46Z"
},
{
"tag": "5.8.1",
"kind": "patch",
"published_at": "2021-05-20T02:06:43Z"
},
{
"tag": "5.8.0",
"kind": "minor",
"published_at": "2021-05-06T02:48:11Z"
},
{
"tag": "5.7.1",
"kind": "patch",
"published_at": "2021-03-17T01:43:23Z"
},
{
"tag": "5.7.0",
"kind": "minor",
"published_at": "2021-02-10T03:44:04Z"
},
{
"tag": "5.6.2",
"kind": "patch",
"published_at": "2020-12-08T07:23:49Z"
},
{
"tag": "5.6.1",
"kind": "patch",
"published_at": "2020-11-25T03:13:16Z"
},
{
"tag": "5.6.0",
"kind": "minor",
"published_at": "2020-11-18T05:34:55Z"
},
{
"tag": "5.5.1",
"kind": "patch",
"published_at": "2020-10-01T05:31:22Z"
},
{
"tag": "5.5.0",
"kind": "minor",
"published_at": "2020-09-29T04:32:21Z"
},
{
"tag": "5.4.2",
"kind": "patch",
"published_at": "2020-08-17T04:00:30Z"
},
{
"tag": "5.4.1",
"kind": "patch",
"published_at": "2020-07-08T04:08:07Z"
},
{
"tag": "5.4.0",
"kind": "minor",
"published_at": "2020-06-30T05:22:55Z"
},
{
"tag": "5.3.2",
"kind": "patch",
"published_at": "2020-06-10T04:52:49Z"
},
{
"tag": "5.3.1",
"kind": "patch",
"published_at": "2020-05-27T04:42:29Z"
},
{
"tag": "4.9.11",
"kind": "patch",
"published_at": "2020-07-13T05:29:19Z"
},
{
"tag": "4.5.12",
"kind": "patch",
"published_at": "2020-07-14T01:53:37Z"
}
],
"recent_commits": [
{
"oid": "23137d1b2f95cdd68f304292685157ba090e7518",
"body": null,
"is_bot": false,
"headline": "Added version 8.8.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-07-15T02:36:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "147b97ffe8a7ccb8ea004aa0999d420d6bc27a6f",
"body": null,
"is_bot": false,
"headline": "Added version 8.7.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-07-01T03:39:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4ec295845c55ee20abd551c98bc42f1079c43c83",
"body": null,
"is_bot": false,
"headline": "Added version 8.6.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-06-03T03:28:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "265989e814097c17f3196d33244a778c4925e80b",
"body": null,
"is_bot": false,
"headline": "Added version 8.5.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-05-19T23:39:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4e5c520b2b6d52a6251316ab2e4af383c5e753bd",
"body": null,
"is_bot": false,
"headline": "Added version 7.9.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-05-19T23:38:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fcfc14e367d0aa6c72d018278776ef22dc2e8a8f",
"body": null,
"is_bot": false,
"headline": "Added version 8.5.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-04-29T05:18:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "268583cbd56a9ed30d38856deab8cfd48727b746",
"body": null,
"is_bot": false,
"headline": "Added version 8.4.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-03-31T06:07:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f05e38fecf76287442dd3301786955a83bbe954f",
"body": null,
"is_bot": false,
"headline": "Added version 7.9.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-02-11T03:44:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4b043a865f1978056f6649638b2e983c0624ff66",
"body": null,
"is_bot": false,
"headline": "Added version 8.3.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-01-14T01:01:47Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d611e7b064eab7808a0d8d581776c5884a5b687a",
"body": null,
"is_bot": false,
"headline": "Added version 8.3.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-12-17T00:53:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f7f49401cf141bbb9abaff53067db88959969a70",
"body": null,
"is_bot": false,
"headline": "Added version 8.3.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-12-10T01:56:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8d7491f2ee341c201b68cc7c3701d54703edd474",
"body": null,
"is_bot": false,
"headline": "Added version 8.2.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-11-17T03:22:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "18afc89787771029c09238e08ef5c6f6b64169b5",
"body": null,
"is_bot": false,
"headline": "Added version 8.2.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-11-06T00:55:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7dcce3851a3c9bec77b73a303c62784a98758d3d",
"body": null,
"is_bot": false,
"headline": "Added version 8.2.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-10-23T01:11:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d93b748fa069acc845901677a97fb701b0eec7ba",
"body": null,
"is_bot": false,
"headline": "Added version 8.1.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-09-18T08:46:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "18b9387d799663ebb9a4631e87bbd8727f4a8656",
"body": null,
"is_bot": false,
"headline": "Added version 8.1.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-09-17T15:22:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "905d51da18b6eae3b233addec8058d6a78575045",
"body": null,
"is_bot": false,
"headline": "Added version 8.1.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-09-17T04:18:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1d90c814d8821567291bc1de2eb84f4da8d6abd4",
"body": null,
"is_bot": false,
"headline": "Added version 8.0.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-08-14T02:39:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "da439f1d4bbfaab97fb59102ad29b325b8313c70",
"body": null,
"is_bot": false,
"headline": "Added version 8.0.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-07-28T04:53:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1b7f5ef6e6e11318ce3749fb60ef517cc3c2adcc",
"body": null,
"is_bot": false,
"headline": "Added version 8.0.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-07-23T02:30:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3d6219296c9a92c87337bb38fb502a469ac1167f",
"body": null,
"is_bot": false,
"headline": "Added version 7.9.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-05-29T02:22:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "41ca209b741864a96b11ca34294b2eeba873ff01",
"body": null,
"is_bot": false,
"headline": "Added version 7.9.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-05-15T01:47:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "88d1b2874256895338034dba28bf6e920aa4ba17",
"body": null,
"is_bot": false,
"headline": "Added version 7.8.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-04-09T02:06:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "841a2f73ed89df874d5abca7286c344353098f14",
"body": null,
"is_bot": false,
"headline": "Added version 7.7.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-03-19T03:36:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c92b29a72c467c07799fd09dc9e0add45cf504a1",
"body": null,
"is_bot": false,
"headline": "Added version 7.7.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-03-05T00:36:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4b04481b24137029525f6dc372706fa9d3168f14",
"body": null,
"is_bot": false,
"headline": "Added version 7.7.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-02-20T08:31:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f0b12677418f3cbb2aeffc2216bd36b0590dd418",
"body": null,
"is_bot": false,
"headline": "Added version 7.6.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-01-22T03:57:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0c4bc43d572ea9673468bf12cc30e8fb556550f4",
"body": null,
"is_bot": false,
"headline": "Added version 7.6.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-12-11T04:56:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3ba28fd6a4037849dbdaf7f6341493b23db9e13c",
"body": null,
"is_bot": false,
"headline": "Added version 7.5.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-11-13T03:16:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca7a694db4fff387bb6ca9775ddd3d3b5eba3d9c",
"body": null,
"is_bot": false,
"headline": "Added version 7.5.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-11-06T03:04:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e4d46be06c8d0d99f542e7199d1283850fb9192c",
"body": null,
"is_bot": false,
"headline": "Added version 7.4.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-10-10T05:50:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d48b4828c5f66dfb5171a71c47671e0d556dc2b4",
"body": null,
"is_bot": false,
"headline": "Added version 7.4.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-10-09T05:28:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e92ab7adaa3db1752639361ded41a7abb2d28996",
"body": null,
"is_bot": false,
"headline": "Added version 7.3.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-08-07T06:30:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db05d34dd0964dd241045cfc319c3a1bd45773e8",
"body": null,
"is_bot": false,
"headline": "Added version 7.2.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-07-03T05:25:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca4b8ce34f4d4f4c1485da90a4247886c4e45335",
"body": null,
"is_bot": false,
"headline": "Added version 7.2.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-06-19T06:08:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c587e0ce032898f6528ffc8374f1ebe3011b9158",
"body": null,
"is_bot": false,
"headline": "Added version 7.1.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-06-05T05:16:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f671e05aca24ac73298ae4922b34607b634d59f4",
"body": null,
"is_bot": false,
"headline": "Added version 7.1.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-05-22T08:18:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "05a2ae86f455231d1734f2442664b6891ec4d8dd",
"body": null,
"is_bot": false,
"headline": "Added version 7.1.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-05-08T05:24:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "863759766e2397d1f639c63d006680a9e8ba6233",
"body": null,
"is_bot": false,
"headline": "Added version 7.0.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-04-10T07:29:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c011b5164178ac5224e658bf2aed713479fc78ae",
"body": null,
"is_bot": false,
"headline": "Added version 7.0.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-03-20T05:46:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "01d1959b1200e0b872ea078e59ea5abfb5c54100",
"body": null,
"is_bot": false,
"headline": "Added version 6.8.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-02-08T23:33:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b0073db409746748af4fc06fbee337bb99f462d9",
"body": null,
"is_bot": false,
"headline": "Added version 6.8.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-12-11T03:21:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "15c7e5ccd1398486b773f2fc48dafc2d2ffaee8f",
"body": null,
"is_bot": false,
"headline": "Added version 6.8.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-11-29T09:44:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "56a705dcfe30211053cae2e21e5c7dc65fa7b083",
"body": null,
"is_bot": false,
"headline": "Added version 6.8.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-11-22T11:14:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2a1344eb95eb8ed512f4ad56986bfc230c8c74c7",
"body": null,
"is_bot": false,
"headline": "Added version 6.7.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-11-15T00:41:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a4c139bde17a4e8b2e84d225020cd5acc24a728a",
"body": null,
"is_bot": false,
"headline": "Added version 6.7.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-10-25T06:42:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b1ddb5ec9b0c7f5d542429a044bd303648d2d647",
"body": null,
"is_bot": false,
"headline": "Added version 6.7.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-10-19T03:04:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "02e194ec4d37aab8335332f8ac3e8d2292ba2d47",
"body": null,
"is_bot": false,
"headline": "Added version 6.7.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-08-30T11:10:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4b795ce4049e2038c79d0ec940de78f17cbe4694",
"body": null,
"is_bot": false,
"headline": "Added version 6.6.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-08-09T04:58:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6d4ca510724901084dde245481129b1cbea3aa74",
"body": null,
"is_bot": false,
"headline": "Added version 6.6.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-08-02T05:17:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "575e3a4a602619a3d9e1cd0d437ce875ff756395",
"body": null,
"is_bot": false,
"headline": "Added version 6.6.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-07-12T06:32:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3212d377b2132acc89c4887941e946fb61b33ee6",
"body": null,
"is_bot": false,
"headline": "Added version 6.5.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-06-19T04:36:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "31251ab0bdc693efb4d510a2d0edb07d47ca355c",
"body": null,
"is_bot": false,
"headline": "Added version 6.5.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-06-13T00:10:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a37da4822eebcd2706793454b07bd891c5277a8",
"body": null,
"is_bot": false,
"headline": "Added version 6.4.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-04-26T10:48:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b2327c03fba64f8c47ec030c1f3bce98da8f7596",
"body": null,
"is_bot": false,
"headline": "Added version 6.4.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-03-29T01:33:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "488a05ddf56e844e593a3fb7da68aa5fb41f01ac",
"body": null,
"is_bot": false,
"headline": "Added version 6.4.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-03-16T00:43:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6880668bef341a0572a8354768bb1f7f53f7121c",
"body": null,
"is_bot": false,
"headline": "Added version 6.3.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-02-22T07:52:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bec6271ca90b2f37db48a955697746c1f58b9358",
"body": null,
"is_bot": false,
"headline": "Added version 6.3.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-12-06T02:19:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "058c00937b0128720e3663d0bfcfe49d2926cf92",
"body": null,
"is_bot": false,
"headline": "Added version 6.3.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-11-23T02:47:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "396dc0d4c4a970918e5a4322c7957c90c85c4c4f",
"body": null,
"is_bot": false,
"headline": "Added version 6.2.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-09-08T04:15:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e6c8b0aa624deb507094918b5dd689d9fea28070",
"body": null,
"is_bot": false,
"headline": "Added version 6.1.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-07-29T00:24:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "34ec83b058c32a19b62a15212995122c1ef79cdd",
"body": null,
"is_bot": false,
"headline": "Added version 6.1.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-07-27T03:47:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c6cbe460317484cb45daec0dbabfe4c1d0bf6cc8",
"body": null,
"is_bot": false,
"headline": "Added version 6.1.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-06-29T05:36:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9563ee68e845cc256cc371a6c76a750a4bab7c15",
"body": null,
"is_bot": false,
"headline": "Added version 6.0.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-05-25T04:10:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6eb0c53e09bd552740dee0ede369f6b97d6983d5",
"body": null,
"is_bot": false,
"headline": "Added version 6.0.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-04-27T03:41:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8898185c29290f52515bbd1ce53816181ce37c0f",
"body": null,
"is_bot": false,
"headline": "Added version 6.0.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-03-23T02:04:52Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "44ce3f31e18e9c70ec8210fe960fdb4941cd59f3",
"body": null,
"is_bot": false,
"headline": "Added version 6.0.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-03-03T04:28:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "dadd7f25e31680f1c6bf61d2fb0b15794f425cd1",
"body": null,
"is_bot": false,
"headline": "Added version 5.10.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-02-09T03:24:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ef9962f1d40abbb80a4fd4f023151fd28f891a6c",
"body": null,
"is_bot": false,
"headline": "Added version 5.10.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-11-17T04:34:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "23dbb5d218707805b74c9fe4f1e2525bcd21e689",
"body": null,
"is_bot": false,
"headline": "Added version 5.10.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-11-03T03:57:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "dbd8fefb0bbe96ed15f9af4518b078ae2c20e020",
"body": null,
"is_bot": false,
"headline": "Added version 5.10.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-10-11T03:18:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "48c665ad12ba0e4d8068ba0784026c7488aa4746",
"body": null,
"is_bot": false,
"headline": "Added version 5.9.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-09-08T03:45:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2692079b210682c63f12418ff613555efec218fd",
"body": null,
"is_bot": false,
"headline": "Added version 5.9.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-08-27T04:39:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7a479e525582d09f315c2cf2a99075d6a798b535",
"body": null,
"is_bot": false,
"headline": "Added version 5.9.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-08-26T05:43:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "dbf8c9ab481e11b660a957257c73f55e2af83b20",
"body": null,
"is_bot": false,
"headline": "Added version 5.8.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-06-23T06:52:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7bbf6f5f7cfa927286523a7681fd20b8489f0709",
"body": null,
"is_bot": false,
"headline": "Added version 5.8.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-05-20T02:06:43Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d2358148183b3887b9d7285b6207a8345da2adc6",
"body": null,
"is_bot": false,
"headline": "Added version 5.8.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-05-06T02:48:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8273fb332de43e7929b7b78c13c72b32871f7394",
"body": null,
"is_bot": false,
"headline": "Added version 5.7.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-03-17T01:43:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "729e1f713c3b6d526daa6cb8f7a3b3ad864c53e3",
"body": null,
"is_bot": false,
"headline": "Added version 5.7.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-02-10T03:44:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "310051defb85fec8581ace8b739ab7b18023db8a",
"body": null,
"is_bot": false,
"headline": "Added version 5.6.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-12-08T07:23:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f78490be294c347958f310e547582856b8aa8101",
"body": null,
"is_bot": false,
"headline": "Added version 5.6.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-11-25T03:13:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "933ded7b599708ed26b7524add7bbce21e777805",
"body": null,
"is_bot": false,
"headline": "Added version 5.6.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-11-18T05:34:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a436d254bc8d62e50be1fdb3d3e98981ab0e4c40",
"body": null,
"is_bot": false,
"headline": "Added version 5.5.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-10-01T05:31:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a2c91ba89b76a3cf1df632ab7f84a608f5ba52a0",
"body": null,
"is_bot": false,
"headline": "Added version 5.5.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-09-29T04:32:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "71197b6a12405d7a6e2067f725c387595bd9b3f4",
"body": null,
"is_bot": false,
"headline": "Added version 5.4.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-08-17T04:00:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "940fdcfa7aa2ade09a1ec916dadeee01baa7787a",
"body": null,
"is_bot": false,
"headline": "Added version 5.4.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-07-08T04:08:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "aa17e50a1302fdb601a56e99b7b59f7abe5ff2a6",
"body": null,
"is_bot": false,
"headline": "Added version 5.4.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-06-30T05:22:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d61fb3a8f356c3e333e0108ac539c32aeadadfb3",
"body": null,
"is_bot": false,
"headline": "Added version 5.3.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-06-10T04:52:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "680aa992f10f6ca37a700d5cfacf18beac86911b",
"body": null,
"is_bot": false,
"headline": "Added version 5.3.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-05-27T04:42:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5831401fd1681524b32992f6c485ef180ea84d2f",
"body": null,
"is_bot": false,
"headline": "Added version 5.3.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-05-21T03:33:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a9e4928aac63b18db3bc670661f8661133c3c205",
"body": null,
"is_bot": false,
"headline": "Added version 5.2.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-04-23T02:47:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "29bd1c22d35ad8a27982fddbe11a84a124c24b40",
"body": null,
"is_bot": false,
"headline": "Added version 5.2.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-03-25T02:45:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3653eec90aba773ebd66183fb867c77af21b2c7c",
"body": null,
"is_bot": false,
"headline": "Added version 5.2.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-02-13T04:02:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1a55d7d048c62c64c3f43734dfaa4bc0d776a035",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.6 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-01-28T05:08:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "26d9f929904015cc5c269418e0b86c522a8f8846",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.5 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-12-19T06:21:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7fcdd149d2e2f6013c78a965b8fab2bbe011de4f",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.4 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-12-11T03:56:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9332192a57fae1d717780486eabfd2d661e3b7e8",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-12-04T03:23:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7587e9a7d09ea0a2ae16f6628918c1bd18df2baa",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-11-19T04:29:44Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "782aa3876f354b8d04fbf1124c4aa440cec9d199",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-10-28T06:39:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a4eca7a227e4dd97ed4356f708f0f481ab5164cb",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-10-17T06:09:31Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 100,
"commits_last_year": 20,
"latest_release_at": "2026-07-15T02:36:42Z",
"latest_release_tag": "8.8.0",
"releases_from_tags": true,
"days_since_last_push": 6,
"active_weeks_last_year": 16,
"days_since_latest_release": 6,
"mean_days_between_releases": 26.7
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 37,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "tinymce",
"exists": true,
"license": "SEE LICENSE IN license.md",
"keywords": [
"wysiwyg",
"tinymce",
"richtext",
"javascript",
"html",
"text",
"rich editor",
"rich text editor",
"rte",
"rich text",
"contenteditable",
"editing"
],
"ecosystem": "npm",
"matches_repo": false,
"registry_url": "https://www.npmjs.com/package/tinymce",
"is_deprecated": false,
"latest_version": "8.8.0",
"repository_url": "https://github.com/tinymce/tinymce",
"versions_count": 218,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 3,
"monthly_downloads": 4489241,
"first_published_at": "2014-05-06T10:59:32.298000Z",
"latest_published_at": "2026-07-15T02:38:50.723000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 6
},
{
"name": "tinymce/tinymce",
"exists": true,
"license": "SEE LICENSE IN license.md",
"keywords": [
"text",
"javascript",
"wysiwyg",
"tinymce",
"html",
"editing",
"richtext",
"contenteditable",
"rte",
"rich editor",
"rich text editor",
"rich text"
],
"ecosystem": "packagist",
"matches_repo": true,
"registry_url": "https://packagist.org/packages/tinymce/tinymce",
"is_deprecated": false,
"latest_version": "8.8.0",
"repository_url": "https://github.com/tinymce/tinymce-dist",
"versions_count": 243,
"total_downloads": 8167016,
"dependents_count": 115,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 173352,
"first_published_at": null,
"latest_published_at": "2026-07-15T02:36:42Z",
"latest_version_yanked": null,
"days_since_latest_publish": 6
}
]
},
"popularity": {
"forks": 158,
"stars": 170,
"watchers": 24,
"fork_history": {
"days": [
{
"date": "2014-09-16",
"count": 1
},
{
"date": "2014-11-03",
"count": 1
},
{
"date": "2014-11-20",
"count": 1
},
{
"date": "2014-11-25",
"count": 1
},
{
"date": "2015-02-05",
"count": 1
},
{
"date": "2015-03-15",
"count": 1
},
{
"date": "2015-03-27",
"count": 1
},
{
"date": "2015-04-24",
"count": 1
},
{
"date": "2015-04-27",
"count": 1
},
{
"date": "2015-05-02",
"count": 1
},
{
"date": "2015-05-19",
"count": 1
},
{
"date": "2015-06-06",
"count": 1
},
{
"date": "2015-06-09",
"count": 1
},
{
"date": "2015-06-25",
"count": 1
},
{
"date": "2015-07-27",
"count": 1
},
{
"date": "2015-07-28",
"count": 1
},
{
"date": "2015-08-17",
"count": 1
},
{
"date": "2015-08-24",
"count": 1
},
{
"date": "2015-09-11",
"count": 1
},
{
"date": "2015-10-02",
"count": 1
},
{
"date": "2015-10-09",
"count": 1
},
{
"date": "2015-10-15",
"count": 1
},
{
"date": "2015-11-19",
"count": 1
},
{
"date": "2015-12-18",
"count": 1
},
{
"date": "2016-02-22",
"count": 1
},
{
"date": "2016-03-23",
"count": 1
},
{
"date": "2016-03-25",
"count": 1
},
{
"date": "2016-03-30",
"count": 1
},
{
"date": "2016-04-06",
"count": 1
},
{
"date": "2016-04-15",
"count": 1
},
{
"date": "2016-04-19",
"count": 1
},
{
"date": "2016-05-27",
"count": 1
},
{
"date": "2016-06-10",
"count": 1
},
{
"date": "2016-07-05",
"count": 1
},
{
"date": "2016-07-07",
"count": 1
},
{
"date": "2016-07-11",
"count": 2
},
{
"date": "2016-08-02",
"count": 1
},
{
"date": "2016-10-22",
"count": 1
},
{
"date": "2016-12-19",
"count": 1
},
{
"date": "2017-02-27",
"count": 1
},
{
"date": "2017-07-12",
"count": 1
},
{
"date": "2017-10-03",
"count": 1
},
{
"date": "2017-10-05",
"count": 1
},
{
"date": "2017-10-07",
"count": 1
},
{
"date": "2017-10-10",
"count": 1
},
{
"date": "2017-11-29",
"count": 1
},
{
"date": "2017-12-07",
"count": 1
},
{
"date": "2017-12-21",
"count": 1
},
{
"date": "2018-01-30",
"count": 1
},
{
"date": "2018-03-07",
"count": 1
},
{
"date": "2018-03-29",
"count": 1
},
{
"date": "2018-04-03",
"count": 1
},
{
"date": "2018-04-09",
"count": 1
},
{
"date": "2018-04-16",
"count": 1
},
{
"date": "2018-07-11",
"count": 1
},
{
"date": "2018-07-16",
"count": 1
},
{
"date": "2018-08-06",
"count": 1
},
{
"date": "2018-08-20",
"count": 1
},
{
"date": "2018-08-23",
"count": 2
},
{
"date": "2018-09-19",
"count": 1
},
{
"date": "2018-09-21",
"count": 1
},
{
"date": "2018-10-04",
"count": 1
},
{
"date": "2018-10-30",
"count": 1
},
{
"date": "2018-11-21",
"count": 1
},
{
"date": "2018-11-28",
"count": 1
},
{
"date": "2018-12-11",
"count": 1
},
{
"date": "2018-12-19",
"count": 1
},
{
"date": "2019-01-09",
"count": 2
},
{
"date": "2019-01-25",
"count": 1
},
{
"date": "2019-02-05",
"count": 1
},
{
"date": "2019-02-10",
"count": 1
},
{
"date": "2019-02-11",
"count": 1
},
{
"date": "2019-03-15",
"count": 1
},
{
"date": "2019-03-30",
"count": 1
},
{
"date": "2019-04-04",
"count": 1
},
{
"date": "2019-04-09",
"count": 1
},
{
"date": "2019-04-29",
"count": 1
},
{
"date": "2019-05-09",
"count": 1
},
{
"date": "2019-06-14",
"count": 1
},
{
"date": "2019-07-12",
"count": 1
},
{
"date": "2019-08-31",
"count": 1
},
{
"date": "2019-10-09",
"count": 1
},
{
"date": "2019-10-11",
"count": 1
},
{
"date": "2019-11-07",
"count": 1
},
{
"date": "2019-11-18",
"count": 1
},
{
"date": "2019-12-28",
"count": 1
},
{
"date": "2020-01-24",
"count": 2
},
{
"date": "2020-02-07",
"count": 1
},
{
"date": "2020-04-02",
"count": 1
},
{
"date": "2020-04-10",
"count": 1
},
{
"date": "2020-04-15",
"count": 1
},
{
"date": "2020-05-04",
"count": 1
},
{
"date": "2020-05-15",
"count": 1
},
{
"date": "2020-05-19",
"count": 1
},
{
"date": "2020-06-01",
"count": 1
},
{
"date": "2020-06-12",
"count": 1
},
{
"date": "2020-06-21",
"count": 1
},
{
"date": "2020-07-01",
"count": 1
},
{
"date": "2020-07-09",
"count": 1
},
{
"date": "2020-07-27",
"count": 1
},
{
"date": "2020-10-14",
"count": 1
},
{
"date": "2020-11-09",
"count": 1
},
{
"date": "2020-12-11",
"count": 1
},
{
"date": "2020-12-14",
"count": 1
},
{
"date": "2021-01-18",
"count": 1
},
{
"date": "2021-01-31",
"count": 1
},
{
"date": "2021-02-06",
"count": 1
},
{
"date": "2021-02-20",
"count": 1
},
{
"date": "2021-03-03",
"count": 1
},
{
"date": "2021-03-19",
"count": 1
},
{
"date": "2021-04-08",
"count": 1
},
{
"date": "2021-05-14",
"count": 1
},
{
"date": "2021-05-21",
"count": 1
},
{
"date": "2021-06-03",
"count": 1
},
{
"date": "2021-06-15",
"count": 1
},
{
"date": "2021-06-29",
"count": 1
},
{
"date": "2021-09-01",
"count": 1
},
{
"date": "2021-09-27",
"count": 1
},
{
"date": "2021-10-06",
"count": 1
},
{
"date": "2021-11-21",
"count": 1
},
{
"date": "2021-11-23",
"count": 1
},
{
"date": "2021-11-25",
"count": 1
},
{
"date": "2022-01-11",
"count": 1
},
{
"date": "2022-01-23",
"count": 1
},
{
"date": "2022-02-16",
"count": 1
},
{
"date": "2022-03-22",
"count": 1
},
{
"date": "2022-04-19",
"count": 1
},
{
"date": "2022-06-14",
"count": 1
},
{
"date": "2022-07-12",
"count": 1
},
{
"date": "2022-07-26",
"count": 1
},
{
"date": "2022-08-01",
"count": 1
},
{
"date": "2022-08-08",
"count": 1
},
{
"date": "2022-08-17",
"count": 1
},
{
"date": "2022-08-22",
"count": 2
},
{
"date": "2022-09-02",
"count": 1
},
{
"date": "2022-09-09",
"count": 1
},
{
"date": "2022-11-09",
"count": 1
},
{
"date": "2023-02-22",
"count": 1
},
{
"date": "2023-03-10",
"count": 1
},
{
"date": "2023-03-26",
"count": 1
},
{
"date": "2023-04-28",
"count": 1
},
{
"date": "2024-08-06",
"count": 1
},
{
"date": "2025-05-29",
"count": 1
},
{
"date": "2025-08-28",
"count": 1
},
{
"date": "2025-08-29",
"count": 1
},
{
"date": "2025-09-19",
"count": 1
}
],
"complete": true,
"collected": 151,
"total_forks": 158
},
"star_history": {
"days": [
{
"date": "2014-05-08",
"count": 1
},
{
"date": "2014-05-15",
"count": 1
},
{
"date": "2014-05-16",
"count": 1
},
{
"date": "2014-05-19",
"count": 1
},
{
"date": "2014-05-31",
"count": 1
},
{
"date": "2014-06-25",
"count": 1
},
{
"date": "2014-07-23",
"count": 1
},
{
"date": "2014-08-15",
"count": 1
},
{
"date": "2014-08-18",
"count": 1
},
{
"date": "2014-10-20",
"count": 1
},
{
"date": "2014-10-27",
"count": 1
},
{
"date": "2014-11-04",
"count": 1
},
{
"date": "2014-11-21",
"count": 1
},
{
"date": "2014-12-29",
"count": 1
},
{
"date": "2015-01-20",
"count": 1
},
{
"date": "2015-02-19",
"count": 1
},
{
"date": "2015-03-17",
"count": 1
},
{
"date": "2015-06-10",
"count": 1
},
{
"date": "2015-06-29",
"count": 1
},
{
"date": "2015-07-08",
"count": 1
},
{
"date": "2015-07-28",
"count": 1
},
{
"date": "2015-08-07",
"count": 1
},
{
"date": "2015-12-01",
"count": 1
},
{
"date": "2015-12-11",
"count": 2
},
{
"date": "2016-01-04",
"count": 1
},
{
"date": "2016-01-07",
"count": 1
},
{
"date": "2016-01-13",
"count": 1
},
{
"date": "2016-02-24",
"count": 1
},
{
"date": "2016-04-21",
"count": 2
},
{
"date": "2016-05-18",
"count": 1
},
{
"date": "2016-09-05",
"count": 1
},
{
"date": "2016-10-25",
"count": 1
},
{
"date": "2017-01-10",
"count": 1
},
{
"date": "2017-01-11",
"count": 1
},
{
"date": "2017-02-14",
"count": 1
},
{
"date": "2017-02-21",
"count": 1
},
{
"date": "2017-03-05",
"count": 1
},
{
"date": "2017-03-30",
"count": 1
},
{
"date": "2017-05-09",
"count": 1
},
{
"date": "2017-06-25",
"count": 1
},
{
"date": "2017-09-10",
"count": 1
},
{
"date": "2017-12-21",
"count": 1
},
{
"date": "2017-12-27",
"count": 1
},
{
"date": "2018-01-03",
"count": 1
},
{
"date": "2018-01-14",
"count": 1
},
{
"date": "2018-02-20",
"count": 1
},
{
"date": "2018-03-20",
"count": 1
},
{
"date": "2018-03-26",
"count": 1
},
{
"date": "2018-04-11",
"count": 1
},
{
"date": "2018-05-17",
"count": 1
},
{
"date": "2018-06-08",
"count": 2
},
{
"date": "2018-06-15",
"count": 1
},
{
"date": "2018-06-29",
"count": 1
},
{
"date": "2018-07-31",
"count": 2
},
{
"date": "2018-08-12",
"count": 1
},
{
"date": "2018-09-01",
"count": 1
},
{
"date": "2018-09-07",
"count": 1
},
{
"date": "2018-09-27",
"count": 1
},
{
"date": "2018-11-03",
"count": 1
},
{
"date": "2019-01-09",
"count": 1
},
{
"date": "2019-02-18",
"count": 1
},
{
"date": "2019-02-28",
"count": 1
},
{
"date": "2019-03-08",
"count": 1
},
{
"date": "2019-03-15",
"count": 1
},
{
"date": "2019-04-07",
"count": 1
},
{
"date": "2019-04-14",
"count": 1
},
{
"date": "2019-04-18",
"count": 1
},
{
"date": "2019-05-30",
"count": 1
},
{
"date": "2019-05-31",
"count": 1
},
{
"date": "2019-06-12",
"count": 1
},
{
"date": "2019-06-14",
"count": 1
},
{
"date": "2019-08-01",
"count": 1
},
{
"date": "2019-08-29",
"count": 1
},
{
"date": "2019-09-04",
"count": 1
},
{
"date": "2019-09-17",
"count": 1
},
{
"date": "2019-10-11",
"count": 1
},
{
"date": "2019-10-15",
"count": 1
},
{
"date": "2019-11-01",
"count": 1
},
{
"date": "2019-11-02",
"count": 1
},
{
"date": "2019-12-09",
"count": 1
},
{
"date": "2020-01-04",
"count": 1
},
{
"date": "2020-01-17",
"count": 1
},
{
"date": "2020-01-19",
"count": 1
},
{
"date": "2020-01-23",
"count": 1
},
{
"date": "2020-01-24",
"count": 1
},
{
"date": "2020-03-16",
"count": 1
},
{
"date": "2020-04-01",
"count": 2
},
{
"date": "2020-04-02",
"count": 1
},
{
"date": "2020-04-23",
"count": 1
},
{
"date": "2020-05-14",
"count": 1
},
{
"date": "2020-05-22",
"count": 2
},
{
"date": "2020-06-16",
"count": 1
},
{
"date": "2020-07-26",
"count": 1
},
{
"date": "2020-09-22",
"count": 1
},
{
"date": "2020-10-05",
"count": 1
},
{
"date": "2020-11-09",
"count": 1
},
{
"date": "2020-11-21",
"count": 1
},
{
"date": "2020-12-23",
"count": 1
},
{
"date": "2021-01-11",
"count": 1
},
{
"date": "2021-01-31",
"count": 1
},
{
"date": "2021-02-02",
"count": 1
},
{
"date": "2021-02-05",
"count": 1
},
{
"date": "2021-03-06",
"count": 1
},
{
"date": "2021-03-17",
"count": 1
},
{
"date": "2021-04-08",
"count": 1
},
{
"date": "2021-04-21",
"count": 1
},
{
"date": "2021-04-22",
"count": 1
},
{
"date": "2021-05-06",
"count": 1
},
{
"date": "2021-07-12",
"count": 1
},
{
"date": "2021-07-13",
"count": 1
},
{
"date": "2021-07-14",
"count": 1
},
{
"date": "2021-07-17",
"count": 1
},
{
"date": "2021-07-21",
"count": 1
},
{
"date": "2021-07-27",
"count": 1
},
{
"date": "2021-08-16",
"count": 1
},
{
"date": "2021-08-17",
"count": 1
},
{
"date": "2021-09-24",
"count": 1
},
{
"date": "2021-10-05",
"count": 1
},
{
"date": "2021-11-21",
"count": 1
},
{
"date": "2021-11-23",
"count": 1
},
{
"date": "2021-12-13",
"count": 1
},
{
"date": "2022-01-29",
"count": 1
},
{
"date": "2022-03-03",
"count": 1
},
{
"date": "2022-03-20",
"count": 1
},
{
"date": "2022-04-21",
"count": 1
},
{
"date": "2022-05-28",
"count": 1
},
{
"date": "2022-06-07",
"count": 1
},
{
"date": "2022-07-01",
"count": 1
},
{
"date": "2022-07-04",
"count": 1
},
{
"date": "2022-09-01",
"count": 1
},
{
"date": "2022-09-28",
"count": 1
},
{
"date": "2022-12-04",
"count": 1
},
{
"date": "2023-02-22",
"count": 1
},
{
"date": "2023-02-25",
"count": 1
},
{
"date": "2023-04-21",
"count": 1
},
{
"date": "2023-05-02",
"count": 1
},
{
"date": "2023-05-27",
"count": 1
},
{
"date": "2023-05-31",
"count": 1
},
{
"date": "2023-06-26",
"count": 1
},
{
"date": "2023-08-13",
"count": 1
},
{
"date": "2023-09-08",
"count": 1
},
{
"date": "2023-10-16",
"count": 1
},
{
"date": "2023-10-23",
"count": 1
},
{
"date": "2023-12-09",
"count": 1
},
{
"date": "2024-02-25",
"count": 1
},
{
"date": "2024-03-25",
"count": 1
},
{
"date": "2024-04-11",
"count": 1
},
{
"date": "2024-07-07",
"count": 1
},
{
"date": "2024-10-25",
"count": 1
},
{
"date": "2024-10-29",
"count": 1
},
{
"date": "2024-12-27",
"count": 1
},
{
"date": "2025-02-24",
"count": 1
},
{
"date": "2025-02-28",
"count": 1
},
{
"date": "2025-06-09",
"count": 1
},
{
"date": "2025-07-03",
"count": 1
},
{
"date": "2025-08-29",
"count": 1
},
{
"date": "2025-10-20",
"count": 1
},
{
"date": "2025-12-17",
"count": 1
},
{
"date": "2026-01-12",
"count": 1
},
{
"date": "2026-01-15",
"count": 1
},
{
"date": "2026-02-06",
"count": 1
},
{
"date": "2026-02-21",
"count": 1
},
{
"date": "2026-06-19",
"count": 1
}
],
"complete": true,
"collected": 169,
"total_stars": 170
},
"open_issues_and_prs": 1
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"toolchain_manifests": [],
"largest_source_bytes": 1895997,
"source_files_sampled": 221,
"oversized_source_files": 22,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"composer.json",
"package.json"
],
"advisories": {
"error": "No resolved dependencies to assess",
"scope": "repository_graph",
"source": null,
"findings": [],
"collected": false,
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm",
"packagist"
],
"dependencies": [],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [],
"collected": true,
"truncated": false,
"total_count": 0,
"direct_count": 0,
"indirect_count": 0
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 0,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 12
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "spocke",
"commits": 74,
"avatar_url": "https://avatars.githubusercontent.com/u/115879?v=4"
},
{
"type": "User",
"login": "jhaines",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/2252638?v=4"
}
],
"contributors_sampled": 2,
"top_contributor_share": 0.987
},
"quality_signals": {
"has_ci": false,
"has_tests": false,
"ci_workflows": [],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 3 contributing companies or organizations -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 9,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 5,
"reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "23137d1b2f95cdd68f304292685157ba090e7518",
"ran_at": "2026-07-21T20:25:32Z",
"aggregate_score": 3.5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/tinymce/tinymce-dist",
"host": "github.com",
"name": "tinymce-dist",
"owner": "tinymce"
},
"metrics": {
"overall": {
"key": "overall",
"band": "at_risk",
"name": "Overall health",
"note": null,
"notes": [],
"value": 48,
"inputs": {
"security": 35,
"vitality": 74,
"community": 61,
"governance": 45,
"engineering": 21
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 74,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 64,
"inputs": {
"commits_last_year": 20,
"human_commit_share": 1,
"days_since_last_push": 6,
"active_weeks_last_year": 16
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 6 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 6
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "16/52 weeks with commits",
"points": 11.1,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 16
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "20 commits in the last year",
"points": 11.9,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 20
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 5,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 88,
"inputs": {
"releases_count": 100,
"latest_release_tag": "8.8.0",
"releases_from_tags": true,
"days_since_latest_release": 6,
"mean_days_between_releases": 26.7
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 version tags (no GitHub releases)",
"points": 16.2,
"status": "partial",
"details": [
{
"code": "version_tags_no_releases",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 6 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 6
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~26.7 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 26.7
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 6,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 6 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 6
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 61,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "moderate",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 62,
"inputs": {
"forks": 158,
"stars": 170,
"watchers": 24,
"growth_state": "organic",
"growth_factor_pct": 100
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "170 stars",
"points": 36.1,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 170
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "158 forks",
"points": 18.3,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 158
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "24 watchers",
"points": 7.6,
"status": "partial",
"details": [
{
"code": "watchers",
"params": {
"count": 24
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "at_risk",
"name": "Community health",
"note": null,
"notes": [],
"value": 44,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "license file present, not a recognized license",
"points": 16.9,
"status": "partial",
"details": [
{
"code": "license_custom",
"params": {}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "good",
"name": "Ecosystem adoption (downloads)",
"note": null,
"notes": [],
"value": 84,
"inputs": {
"packages": [
"tinymce/tinymce"
],
"dependents": 115,
"ecosystems": "packagist",
"total_downloads": 8167016,
"monthly_downloads": 173352
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "173,352 downloads/month across packagist",
"points": 69.9,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 173352,
"ecosystems": "packagist"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "115 packages depend on it",
"points": 13.8,
"status": "partial",
"details": [
{
"code": "registry_dependents",
"params": {
"count": 115
}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "at_risk",
"name": "Sustainability & Governance",
"value": 45,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 22,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 2,
"top_contributor_share": 0.987
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 99% of commits",
"points": 0.3,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 99
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "2 contributors",
"points": 2.7,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 2
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 3 contributing companies or organizations -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "critical",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"merged_prs": 0,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 12
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "0/12 decided PRs merged",
"points": 0,
"status": "missed",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 0,
"decided": 12
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "good",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 74,
"inputs": {
"followers": 418,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "tinymce",
"public_repos": 102,
"account_age_days": 6173
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "418 followers of tinymce",
"points": 18.9,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 418,
"login": "tinymce"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "102 public repos, account ~16 yr old",
"points": 25,
"status": "met",
"details": [
{
"code": "public_repos",
"params": {
"count": 102
}
},
{
"code": "account_age_years",
"params": {
"years": 16
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"tinymce/tinymce"
],
"ecosystems": "packagist",
"any_deprecated": false,
"min_days_since_publish": 6
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on packagist",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "packagist"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 6 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 6
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "243 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 243
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "critical",
"name": "Engineering Quality",
"value": 21,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "critical",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_ci": false,
"has_tests": false,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"topics": [
"tinymce"
],
"has_wiki": false,
"homepage": null,
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "1 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 1
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 35,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): CI-Tests, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"ci_tests",
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 35,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 12,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 6,
"scorecard_aggregate": 3.5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 3 contributing companies or organizations -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.2,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 1
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 10,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "0 of 100 human commits state their intent (structured subject or explanatory body)",
"points": 0,
"status": "missed",
"details": [
{
"code": "legible_history",
"params": {
"legible": 0,
"sampled": 100
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "critical",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_nix": false,
"has_tests": false,
"lockfiles": [],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": 0,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no agent-authored commits among the last 100",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_authored_commits",
"params": {
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no automated dependency updates observed",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_dependency_automation",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"primary_language": "JavaScript",
"largest_source_bytes": 1895997,
"source_files_sampled": 221,
"oversized_source_files": 22
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "JavaScript without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "JavaScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "22/221 source files over 60KB",
"points": 49.5,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 221,
"oversized": 22
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring",
"deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead"
],
"report_type": "repository",
"generated_at": "2026-07-21T20:25:38.248671Z",
"schema_version": "0.23.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/t/tinymce/tinymce-dist.svg",
"full_name": "tinymce/tinymce-dist",
"license_state": "custom",
"license_spdx": null
}Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v1.13.0, schema v0.23.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm, Packagist.