Öffentliches Register
Software-GesundheitsberichtSchema 0.23.0 · Metriken 1.13.0 · 2026-07-21 20:25 UTC

tinymce / tinymce-dist

Official TinyMCE repository for production usage in package managers

JavaScript · CSSEigene Lizenz★ 170 Sterne⑂ 158 Forksseit Mai 2014Auf GitHub ansehen ↗

tinymce/tinymce-dist erreicht einen Gesundheitsindex von 48 von 100 und liegt damit im Bereich Gefährdet. Am stärksten schneidet es bei Vitality (74/100) ab, am schwächsten bei AI Readiness (10/100). Zuletzt vor 6 Tagen aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.

48
gesamt / 100
Gefährdet

Software-Gesundheitsindex

Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.

48
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
VitalitätCommunity &VerbreitungNachhaltigkeit &GovernanceEngineering-QualitätSicherheitAI Readiness

Bewertungsprofil

Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.

Eigentümerschaft

TinyOrganisation
418 Follower102 öffentliche Reposseit Aug. 2009

Dieses Repository wird von einer Organisation getragen — geteilte, rechenschaftspflichtige Trägerschaft, die jeden einzelnen Maintainer überdauern kann.

Paket-Ökosysteme

RegistryPaketVersionDownloads / MonatVersionenZuletzt veröffentlichtTags
npmtinymceverweist auf ein anderes Repo — nicht bewertet8.8.04.489.241218vor 6 Tagenwysiwygtinymcerichtextjavascripthtmltextrich-editorrich-text-editorrterich-textcontenteditableediting
Packagisttinymce/tinymce8.8.0173.352243vor 6 Tagentextjavascriptwysiwygtinymcehtmleditingrichtextcontenteditablerterich-editorrich-text-editorrich-text

Metriken nach Kategorie

Vitalität

Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?

74Gut · 22 % des Gesamtindex
Wie die Bewertung erfolgt
36/36Push-Aktualität — letzter Push vor 6 Tagen
11.1/36Commit-Rhythmus — 16/52 Wochen mit Commits
11.9/18Commit-Volumen — 20 Commits im letzten Jahr
5/10OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
Verwendete Eingangsdaten
commits_last_year20
human_commit_share1
days_since_last_push6
active_weeks_last_year16
Wie die Bewertung erfolgt
16.2/27Liefert Releases aus — 100 Versions-Tags (keine GitHub-Releases)
36/36Release-Aktualität — letztes Release vor 6 Tagen
27/27Release-Rhythmus — ein Release etwa alle 26,7 Tage
0/10OpenSSF Scorecard: Signed-Releases — keine Daten
Verwendete Eingangsdaten
releases_count100
latest_release_tag8.8.0
releases_from_tagsja
days_since_latest_release6
mean_days_between_releases26,7
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Signed-Releases. Die verbleibenden Gewichte wurden renormalisiert.

Community & Verbreitung

Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?

61Mittel · 18 % des Gesamtindex
Wie die Bewertung erfolgt
36.1/60Stars — 170 Stars
18.3/25Forks — 158 Forks
7.6/15Watcher — 24 Watcher
Verwendete Eingangsdaten
forks158
stars170
watchers24
growth_stateorganic
growth_factor_pct100
Wie die Bewertung erfolgt
22.5/22.5README
16.9/22.5Lizenz — Lizenzdatei vorhanden, keine anerkannte Lizenz
0/18CONTRIBUTING-Leitfaden
0/13.5Verhaltenskodex
0/7.2Issue-Vorlage
0/6.3PR-Vorlage
Verwendete Eingangsdaten
has_readmeja
has_licenseja
has_contributingnein
has_issue_templatenein
has_code_of_conductnein
has_pull_request_templatenein
Wie die Bewertung erfolgt
69.9/80Downloads pro Monat — 173.352 Downloads/Monat über packagist
13.8/20Abhängige in der Registry — 115 Pakete hängen davon ab
Verwendete Eingangsdaten
packagestinymce/tinymce
dependents115
ecosystemspackagist
total_downloads8.167.016
monthly_downloads173.352

Nachhaltigkeit & Governance

Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?

45Gefährdet · 24 % des Gesamtindex
Wie die Bewertung erfolgt
9/54Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab
0.3/22.5Commit-Verteilung — wichtigste beitragende Person verfasste 99 % der Commits
2.7/13.5Breite der Beitragenden — 2 Beitragende
10/10OpenSSF Scorecard: Contributors — project has 3 contributing companies or organizations -- score normalized to 10
Verwendete Eingangsdaten
bus_factor1
contributors_sampled2
top_contributor_share0,987
Wie die Bewertung erfolgt
0/46.8Issue-Lösungsquote — keine Issues oder keine Daten
0/38.3PR-Annahme — 0/12 entschiedene PRs gemergt
0/15OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0
Verwendete Eingangsdaten
merged_prs0
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs12
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Issue-Lösungsquote. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
30/30Organisatorische Trägerschaft — im Besitz einer Organisation
0/20Verifizierte Domain
18.9/25Reichweite des Inhabers — 418 Follower von tinymce
25/25Kontohistorie — 102 öffentliche Repos, Kontoalter ca. 16 Jahre
Verwendete Eingangsdaten
followers418
owner_typeOrganization
is_verified
owner_logintinymce
public_repos102
account_age_days6.173

Paketpflege

100Exzellent
Wie die Bewertung erfolgt
25/25Veröffentlicht & auflösbar — 1 Paket(e) auf packagist
35/35Veröffentlichungsaktualität — letzte Veröffentlichung vor 6 Tagen
20/20Versionshistorie — 243 veröffentlichte Versionen
20/20Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen
Verwendete Eingangsdaten
packagestinymce/tinymce
ecosystemspackagist
any_deprecatednein
min_days_since_publish6

Engineering-Qualität

Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?

21Kritisch · 20 % des Gesamtindex
Wie die Bewertung erfolgt
0/24CI-Workflows
0/24Tests vorhanden
0/16Linter-Konfiguration
0/9.6Pre-Commit-Hooks
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — keine Daten
Verwendete Eingangsdaten
has_cinein
has_testsnein
has_editorconfignein
has_linter_confignein
has_precommit_confignein
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: CI-Tests. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
30/30README
0/25Dokumentationsverzeichnis
0/15Dokumentations-/Homepage-Site
10/10Repository-Beschreibung
10/10Topics — 1 Topics
0/10Wiki
Verwendete Eingangsdaten
topicstinymce
has_wikinein
homepage
has_readmeja
has_docs_dirnein
has_descriptionja

Sicherheit

Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?

35Gefährdet · 16 % des Gesamtindex

Sicherheitslage

35Gefährdet
Wie die Bewertung erfolgt
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
0/2.5CI-Tests — keine Daten
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/30 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 3 contributing companies or organizations -- score normalized to 10
0/10Dangerous-Workflow — keine Daten
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.2/2.5Lizenz — license file detected
3.8/7.5Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
0/5Packaging — keine Daten
0/5Pinned-Dependencies — keine Daten
0/5SAST — no SAST tool detected
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — keine Daten
0/7.5Token-Permissions — keine Daten
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Verwendete Eingangsdaten
sourceopenssf_scorecard
checks_evaluated12
scorecard_versionv5.5.0
checks_inconclusive6
scorecard_aggregate3,5
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): ci_tests, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Die verbleibenden Gewichte wurden renormalisiert.

AI Readiness

Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.

10Kritisch · 0 % des Gesamtindex
Wie die Bewertung erfolgt
0/45Agentenanweisungen — keine CLAUDE.md / AGENTS.md / Editor-Regeln
0/15Maschinenlesbare Doku (llms.txt)
0/40Lesbare Commit-Historie — 0 von 100 menschlichen Commits benennen ihre Absicht (strukturierter Betreff oder erläuternder Text)
Verwendete Eingangsdaten
has_llms_txtnein
legible_history_share0
agent_instruction_files
agent_instruction_max_bytes
Wie die Bewertung erfolgt
0/18Bootstrap mit einem Befehl
0/22Automatisierte Tests
0/11Lint-/Format-Konfiguration
0/11Statische Typprüfung
0/10Reproduzierbare Umgebung
0/10Belegte Agentenpraxis — keine von Agenten verfassten Commits unter den letzten 100
0/8Automatisierte Wartung — keine automatisierten Abhängigkeits-Updates beobachtet
0/10OpenSSF Scorecard: Pinned-Dependencies — keine Daten
Verwendete Eingangsdaten
has_nixnein
has_testsnein
lockfiles
has_dockerfilenein
typed_languagenein
bootstrap_files
has_devcontainernein
has_linter_confignein
typecheck_configs
agent_commit_share0
toolchain_manifests
dependency_bot_commit_share0
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: Pinned-Dependencies. Die verbleibenden Gewichte wurden renormalisiert.
Wie die Bewertung erfolgt
0/45Typprüfbarer Code — JavaScript ohne Typprüfungs-Konfiguration
49.5/55Handhabbare Dateigrößen — 22/221 Quelldateien über 60 KB
Verwendete Eingangsdaten
primary_languageJavaScript
largest_source_bytes1.895.997
source_files_sampled221
oversized_source_files22

Eckdaten

170GitHub-Sterne
2Mitwirkende
20Commits, letzte 12 Monate
6Tage seit letztem Push
100Releases
1Bus-Faktor
0offene Issues
npm, PackagistPaket-Ökosysteme

Warnungen zur Datenerhebung

  • npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring
  • deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead

Weitere Details

Stern- und Fork-Verlauf 170 ★ / 158 ⇿
170Sterne
158Forks
98Releases

Wann jeder Stern und Fork hinzugefügt wurde, von GitHub erfasst und nach Tagen gruppiert. Das kumulierte Wachstum steht direkt über den täglichen Zugängen, aus denen es besteht, sodass beide gegeneinander lesbar sind: stetiger organischer Zuwachs sieht ganz anders aus als ein abrupter, kurzlebiger Ausschlag. Wo dieser Unterschied messbar ist, wird er als Wachstumsauthentizität ausgewiesen.

0408012016020016915142014-052020-052026-06
Major 3Minor 30Patch 65

Jeder Punkt umfasst 12 Tage.

OpenSSF Scorecard 3.5 / 10
3.5Gesamtwert

Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).Scorecard v5.5.0 · 2026-07-21 20:25 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
k. A.CI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/30 approved changesets -- score normalized to 0
10Contributorsproject has 3 contributing companies or organizations -- score normalized to 10
k. A.Dangerous-Workflowno workflows found
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
9Licenselicense file detected
5Maintained6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
k. A.Packagingpackaging workflow not detected
k. A.Pinned-Dependenciesno dependencies found
0SASTno SAST tool detected
0Security-Policysecurity policy file not detected
k. A.Signed-Releasesno releases found
k. A.Token-PermissionsNo tokens found
10Vulnerabilities0 existing vulnerabilities detected
Alle Abhängigkeiten 0

Vollständig aufgelöster Abhängigkeitssatz aus dem GitHub-Abhängigkeitsgraphen: 0 direkte und 0 indirekte (transitive) Pakete. Die transitive Hülle ist vollständig, wenn das Repository eine Lockfile eincheckt.

RegistryPaketVersionBeziehung
Abhängigkeits-Advisories nicht bewertet

Der Advisory-Abgleich konnte für diesen Bericht nicht ausgeführt werden: No resolved dependencies to assess

JSON-Rohbericht maschinenlesbar
{
  "data": {
    "repo": {
      "topics": [
        "tinymce"
      ],
      "is_fork": false,
      "size_kb": 51419,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "CSS": 1221547,
        "JavaScript": 5155732,
        "TypeScript": 270304
      },
      "pushed_at": "2026-07-15T02:36:44Z",
      "created_at": "2014-05-06T10:57:12Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-15T02:36:49Z",
      "description": "Official TinyMCE repository for production usage in package managers",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": null,
      "default_branch": "master",
      "license_spdx_raw": "NOASSERTION",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript",
        "CSS"
      ]
    },
    "owner": {
      "blog": "https://www.tiny.cloud/",
      "name": "Tiny",
      "type": "Organization",
      "login": "tinymce",
      "company": null,
      "location": null,
      "followers": 418,
      "avatar_url": "https://avatars.githubusercontent.com/u/119815?v=4",
      "created_at": "2009-08-26T18:15:21Z",
      "is_verified": null,
      "public_repos": 102,
      "account_age_days": 6173
    },
    "license": {
      "state": "custom",
      "spdx_id": null,
      "raw_spdx": "NOASSERTION",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "8.8.0",
          "kind": "minor",
          "published_at": "2026-07-15T02:36:42Z"
        },
        {
          "tag": "8.7.0",
          "kind": "minor",
          "published_at": "2026-07-01T03:39:33Z"
        },
        {
          "tag": "8.6.0",
          "kind": "minor",
          "published_at": "2026-06-03T03:28:15Z"
        },
        {
          "tag": "8.5.1",
          "kind": "patch",
          "published_at": "2026-05-19T23:39:20Z"
        },
        {
          "tag": "8.5.0",
          "kind": "minor",
          "published_at": "2026-04-29T05:18:45Z"
        },
        {
          "tag": "8.4.0",
          "kind": "minor",
          "published_at": "2026-03-31T06:07:53Z"
        },
        {
          "tag": "8.3.2",
          "kind": "patch",
          "published_at": "2026-01-14T01:01:47Z"
        },
        {
          "tag": "8.3.1",
          "kind": "patch",
          "published_at": "2025-12-17T00:53:22Z"
        },
        {
          "tag": "8.3.0",
          "kind": "minor",
          "published_at": "2025-12-10T01:56:11Z"
        },
        {
          "tag": "8.2.2",
          "kind": "patch",
          "published_at": "2025-11-17T03:22:11Z"
        },
        {
          "tag": "8.2.1",
          "kind": "patch",
          "published_at": "2025-11-06T00:55:35Z"
        },
        {
          "tag": "8.2.0",
          "kind": "minor",
          "published_at": "2025-10-23T01:11:24Z"
        },
        {
          "tag": "8.1.2",
          "kind": "patch",
          "published_at": "2025-09-18T08:46:07Z"
        },
        {
          "tag": "8.1.1",
          "kind": "patch",
          "published_at": "2025-09-17T15:22:02Z"
        },
        {
          "tag": "8.1.0",
          "kind": "minor",
          "published_at": "2025-09-17T04:18:06Z"
        },
        {
          "tag": "8.0.2",
          "kind": "patch",
          "published_at": "2025-08-14T02:39:07Z"
        },
        {
          "tag": "8.0.1",
          "kind": "patch",
          "published_at": "2025-07-28T04:53:13Z"
        },
        {
          "tag": "8.0.0",
          "kind": "major",
          "published_at": "2025-07-23T02:30:15Z"
        },
        {
          "tag": "7.9.3",
          "kind": "patch",
          "published_at": "2026-05-19T23:38:56Z"
        },
        {
          "tag": "7.9.2",
          "kind": "patch",
          "published_at": "2026-02-11T03:44:54Z"
        },
        {
          "tag": "7.9.1",
          "kind": "patch",
          "published_at": "2025-05-29T02:22:36Z"
        },
        {
          "tag": "7.9.0",
          "kind": "minor",
          "published_at": "2025-05-15T01:47:37Z"
        },
        {
          "tag": "7.8.0",
          "kind": "minor",
          "published_at": "2025-04-09T02:06:27Z"
        },
        {
          "tag": "7.7.2",
          "kind": "patch",
          "published_at": "2025-03-19T03:36:58Z"
        },
        {
          "tag": "7.7.1",
          "kind": "patch",
          "published_at": "2025-03-05T00:36:32Z"
        },
        {
          "tag": "7.7.0",
          "kind": "minor",
          "published_at": "2025-02-20T08:31:02Z"
        },
        {
          "tag": "7.6.1",
          "kind": "patch",
          "published_at": "2025-01-22T03:57:00Z"
        },
        {
          "tag": "7.6.0",
          "kind": "minor",
          "published_at": "2024-12-11T04:56:37Z"
        },
        {
          "tag": "7.5.1",
          "kind": "patch",
          "published_at": "2024-11-13T03:16:27Z"
        },
        {
          "tag": "7.5.0",
          "kind": "minor",
          "published_at": "2024-11-06T03:04:46Z"
        },
        {
          "tag": "7.4.1",
          "kind": "patch",
          "published_at": "2024-10-10T05:50:45Z"
        },
        {
          "tag": "7.4.0",
          "kind": "minor",
          "published_at": "2024-10-09T05:28:03Z"
        },
        {
          "tag": "7.3.0",
          "kind": "minor",
          "published_at": "2024-08-07T06:30:33Z"
        },
        {
          "tag": "7.2.1",
          "kind": "patch",
          "published_at": "2024-07-03T05:25:26Z"
        },
        {
          "tag": "7.2.0",
          "kind": "minor",
          "published_at": "2024-06-19T06:08:58Z"
        },
        {
          "tag": "7.1.2",
          "kind": "patch",
          "published_at": "2024-06-05T05:16:22Z"
        },
        {
          "tag": "7.1.1",
          "kind": "patch",
          "published_at": "2024-05-22T08:18:50Z"
        },
        {
          "tag": "7.1.0",
          "kind": "minor",
          "published_at": "2024-05-08T05:24:56Z"
        },
        {
          "tag": "7.0.1",
          "kind": "patch",
          "published_at": "2024-04-10T07:29:34Z"
        },
        {
          "tag": "7.0.0",
          "kind": "major",
          "published_at": "2024-03-20T05:46:56Z"
        },
        {
          "tag": "6.8.6",
          "kind": "patch",
          "published_at": "2025-05-29T02:36:52Z"
        },
        {
          "tag": "6.8.5",
          "kind": "patch",
          "published_at": "2024-10-10T06:06:02Z"
        },
        {
          "tag": "6.8.4",
          "kind": "patch",
          "published_at": "2024-06-19T09:28:48Z"
        },
        {
          "tag": "6.8.3",
          "kind": "patch",
          "published_at": "2024-02-08T23:33:30Z"
        },
        {
          "tag": "6.8.2",
          "kind": "patch",
          "published_at": "2023-12-11T03:21:56Z"
        },
        {
          "tag": "6.8.1",
          "kind": "patch",
          "published_at": "2023-11-29T09:44:11Z"
        },
        {
          "tag": "6.8.0",
          "kind": "minor",
          "published_at": "2023-11-22T11:14:25Z"
        },
        {
          "tag": "6.7.3",
          "kind": "patch",
          "published_at": "2023-11-15T00:41:51Z"
        },
        {
          "tag": "6.7.2",
          "kind": "patch",
          "published_at": "2023-10-25T06:42:18Z"
        },
        {
          "tag": "6.7.1",
          "kind": "patch",
          "published_at": "2023-10-19T03:04:57Z"
        },
        {
          "tag": "6.7.0",
          "kind": "minor",
          "published_at": "2023-08-30T11:10:35Z"
        },
        {
          "tag": "6.6.2",
          "kind": "patch",
          "published_at": "2023-08-09T04:58:32Z"
        },
        {
          "tag": "6.6.1",
          "kind": "patch",
          "published_at": "2023-08-02T05:17:12Z"
        },
        {
          "tag": "6.6.0",
          "kind": "minor",
          "published_at": "2023-07-12T06:32:00Z"
        },
        {
          "tag": "6.5.1",
          "kind": "patch",
          "published_at": "2023-06-19T04:36:46Z"
        },
        {
          "tag": "6.5.0",
          "kind": "minor",
          "published_at": "2023-06-13T00:10:53Z"
        },
        {
          "tag": "6.4.2",
          "kind": "patch",
          "published_at": "2023-04-26T10:48:15Z"
        },
        {
          "tag": "6.4.1",
          "kind": "patch",
          "published_at": "2023-03-29T01:33:40Z"
        },
        {
          "tag": "6.4.0",
          "kind": "minor",
          "published_at": "2023-03-16T00:43:05Z"
        },
        {
          "tag": "6.3.2",
          "kind": "patch",
          "published_at": "2023-02-22T07:52:19Z"
        },
        {
          "tag": "6.3.1",
          "kind": "patch",
          "published_at": "2022-12-06T02:19:08Z"
        },
        {
          "tag": "6.3.0",
          "kind": "minor",
          "published_at": "2022-11-23T02:47:17Z"
        },
        {
          "tag": "6.2.0",
          "kind": "minor",
          "published_at": "2022-09-08T04:15:30Z"
        },
        {
          "tag": "6.1.2",
          "kind": "patch",
          "published_at": "2022-07-29T00:24:40Z"
        },
        {
          "tag": "6.1.1",
          "kind": "patch",
          "published_at": "2022-07-27T03:47:09Z"
        },
        {
          "tag": "6.1.0",
          "kind": "minor",
          "published_at": "2022-06-29T05:36:09Z"
        },
        {
          "tag": "6.0.3",
          "kind": "patch",
          "published_at": "2022-05-25T04:10:33Z"
        },
        {
          "tag": "6.0.2",
          "kind": "patch",
          "published_at": "2022-04-27T03:41:08Z"
        },
        {
          "tag": "6.0.1",
          "kind": "patch",
          "published_at": "2022-03-23T02:04:52Z"
        },
        {
          "tag": "6.0.0",
          "kind": "major",
          "published_at": "2022-03-03T04:28:36Z"
        },
        {
          "tag": "5.10.9",
          "kind": "patch",
          "published_at": "2023-11-15T00:42:08Z"
        },
        {
          "tag": "5.10.8",
          "kind": "patch",
          "published_at": "2023-10-19T03:02:47Z"
        },
        {
          "tag": "5.10.7",
          "kind": "patch",
          "published_at": "2022-12-07T03:50:54Z"
        },
        {
          "tag": "5.10.6",
          "kind": "patch",
          "published_at": "2022-10-19T02:16:29Z"
        },
        {
          "tag": "5.10.5",
          "kind": "patch",
          "published_at": "2022-05-25T04:08:16Z"
        },
        {
          "tag": "5.10.4",
          "kind": "patch",
          "published_at": "2022-04-27T03:39:26Z"
        },
        {
          "tag": "5.10.3",
          "kind": "patch",
          "published_at": "2022-02-09T03:24:06Z"
        },
        {
          "tag": "5.10.2",
          "kind": "patch",
          "published_at": "2021-11-17T04:34:27Z"
        },
        {
          "tag": "5.10.1",
          "kind": "patch",
          "published_at": "2021-11-03T03:57:12Z"
        },
        {
          "tag": "5.10.0",
          "kind": "minor",
          "published_at": "2021-10-11T03:18:15Z"
        },
        {
          "tag": "5.9.2",
          "kind": "patch",
          "published_at": "2021-09-08T03:45:09Z"
        },
        {
          "tag": "5.9.1",
          "kind": "patch",
          "published_at": "2021-08-27T04:39:18Z"
        },
        {
          "tag": "5.9.0",
          "kind": "minor",
          "published_at": "2021-08-26T05:43:13Z"
        },
        {
          "tag": "5.8.2",
          "kind": "patch",
          "published_at": "2021-06-23T06:52:46Z"
        },
        {
          "tag": "5.8.1",
          "kind": "patch",
          "published_at": "2021-05-20T02:06:43Z"
        },
        {
          "tag": "5.8.0",
          "kind": "minor",
          "published_at": "2021-05-06T02:48:11Z"
        },
        {
          "tag": "5.7.1",
          "kind": "patch",
          "published_at": "2021-03-17T01:43:23Z"
        },
        {
          "tag": "5.7.0",
          "kind": "minor",
          "published_at": "2021-02-10T03:44:04Z"
        },
        {
          "tag": "5.6.2",
          "kind": "patch",
          "published_at": "2020-12-08T07:23:49Z"
        },
        {
          "tag": "5.6.1",
          "kind": "patch",
          "published_at": "2020-11-25T03:13:16Z"
        },
        {
          "tag": "5.6.0",
          "kind": "minor",
          "published_at": "2020-11-18T05:34:55Z"
        },
        {
          "tag": "5.5.1",
          "kind": "patch",
          "published_at": "2020-10-01T05:31:22Z"
        },
        {
          "tag": "5.5.0",
          "kind": "minor",
          "published_at": "2020-09-29T04:32:21Z"
        },
        {
          "tag": "5.4.2",
          "kind": "patch",
          "published_at": "2020-08-17T04:00:30Z"
        },
        {
          "tag": "5.4.1",
          "kind": "patch",
          "published_at": "2020-07-08T04:08:07Z"
        },
        {
          "tag": "5.4.0",
          "kind": "minor",
          "published_at": "2020-06-30T05:22:55Z"
        },
        {
          "tag": "5.3.2",
          "kind": "patch",
          "published_at": "2020-06-10T04:52:49Z"
        },
        {
          "tag": "5.3.1",
          "kind": "patch",
          "published_at": "2020-05-27T04:42:29Z"
        },
        {
          "tag": "4.9.11",
          "kind": "patch",
          "published_at": "2020-07-13T05:29:19Z"
        },
        {
          "tag": "4.5.12",
          "kind": "patch",
          "published_at": "2020-07-14T01:53:37Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "23137d1b2f95cdd68f304292685157ba090e7518",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-07-15T02:36:42Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "147b97ffe8a7ccb8ea004aa0999d420d6bc27a6f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-07-01T03:39:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4ec295845c55ee20abd551c98bc42f1079c43c83",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-06-03T03:28:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "265989e814097c17f3196d33244a778c4925e80b",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-05-19T23:39:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4e5c520b2b6d52a6251316ab2e4af383c5e753bd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-05-19T23:38:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fcfc14e367d0aa6c72d018278776ef22dc2e8a8f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-04-29T05:18:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "268583cbd56a9ed30d38856deab8cfd48727b746",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-03-31T06:07:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f05e38fecf76287442dd3301786955a83bbe954f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-02-11T03:44:54Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b043a865f1978056f6649638b2e983c0624ff66",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-01-14T01:01:47Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d611e7b064eab7808a0d8d581776c5884a5b687a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-12-17T00:53:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f7f49401cf141bbb9abaff53067db88959969a70",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-12-10T01:56:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8d7491f2ee341c201b68cc7c3701d54703edd474",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-11-17T03:22:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18afc89787771029c09238e08ef5c6f6b64169b5",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-11-06T00:55:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7dcce3851a3c9bec77b73a303c62784a98758d3d",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-10-23T01:11:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d93b748fa069acc845901677a97fb701b0eec7ba",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-18T08:46:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18b9387d799663ebb9a4631e87bbd8727f4a8656",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-17T15:22:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "905d51da18b6eae3b233addec8058d6a78575045",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-17T04:18:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1d90c814d8821567291bc1de2eb84f4da8d6abd4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-08-14T02:39:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "da439f1d4bbfaab97fb59102ad29b325b8313c70",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-07-28T04:53:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1b7f5ef6e6e11318ce3749fb60ef517cc3c2adcc",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-07-23T02:30:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3d6219296c9a92c87337bb38fb502a469ac1167f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-05-29T02:22:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "41ca209b741864a96b11ca34294b2eeba873ff01",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-05-15T01:47:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "88d1b2874256895338034dba28bf6e920aa4ba17",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-04-09T02:06:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "841a2f73ed89df874d5abca7286c344353098f14",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-03-19T03:36:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c92b29a72c467c07799fd09dc9e0add45cf504a1",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-03-05T00:36:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b04481b24137029525f6dc372706fa9d3168f14",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-02-20T08:31:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f0b12677418f3cbb2aeffc2216bd36b0590dd418",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-01-22T03:57:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0c4bc43d572ea9673468bf12cc30e8fb556550f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-12-11T04:56:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3ba28fd6a4037849dbdaf7f6341493b23db9e13c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-11-13T03:16:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ca7a694db4fff387bb6ca9775ddd3d3b5eba3d9c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-11-06T03:04:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e4d46be06c8d0d99f542e7199d1283850fb9192c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-10-10T05:50:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d48b4828c5f66dfb5171a71c47671e0d556dc2b4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-10-09T05:28:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e92ab7adaa3db1752639361ded41a7abb2d28996",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-08-07T06:30:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "db05d34dd0964dd241045cfc319c3a1bd45773e8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-07-03T05:25:26Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ca4b8ce34f4d4f4c1485da90a4247886c4e45335",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-06-19T06:08:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c587e0ce032898f6528ffc8374f1ebe3011b9158",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-06-05T05:16:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f671e05aca24ac73298ae4922b34607b634d59f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-05-22T08:18:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "05a2ae86f455231d1734f2442664b6891ec4d8dd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-05-08T05:24:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "863759766e2397d1f639c63d006680a9e8ba6233",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-04-10T07:29:34Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c011b5164178ac5224e658bf2aed713479fc78ae",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-03-20T05:46:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "01d1959b1200e0b872ea078e59ea5abfb5c54100",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-02-08T23:33:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b0073db409746748af4fc06fbee337bb99f462d9",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-12-11T03:21:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "15c7e5ccd1398486b773f2fc48dafc2d2ffaee8f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-29T09:44:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "56a705dcfe30211053cae2e21e5c7dc65fa7b083",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-22T11:14:25Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2a1344eb95eb8ed512f4ad56986bfc230c8c74c7",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-15T00:41:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a4c139bde17a4e8b2e84d225020cd5acc24a728a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-10-25T06:42:18Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b1ddb5ec9b0c7f5d542429a044bd303648d2d647",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-10-19T03:04:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "02e194ec4d37aab8335332f8ac3e8d2292ba2d47",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-30T11:10:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b795ce4049e2038c79d0ec940de78f17cbe4694",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-09T04:58:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6d4ca510724901084dde245481129b1cbea3aa74",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-02T05:17:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "575e3a4a602619a3d9e1cd0d437ce875ff756395",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-07-12T06:32:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3212d377b2132acc89c4887941e946fb61b33ee6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-06-19T04:36:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "31251ab0bdc693efb4d510a2d0edb07d47ca355c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-06-13T00:10:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6a37da4822eebcd2706793454b07bd891c5277a8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-04-26T10:48:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b2327c03fba64f8c47ec030c1f3bce98da8f7596",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-03-29T01:33:40Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "488a05ddf56e844e593a3fb7da68aa5fb41f01ac",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-03-16T00:43:05Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6880668bef341a0572a8354768bb1f7f53f7121c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-02-22T07:52:19Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bec6271ca90b2f37db48a955697746c1f58b9358",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-12-06T02:19:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "058c00937b0128720e3663d0bfcfe49d2926cf92",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-11-23T02:47:17Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "396dc0d4c4a970918e5a4322c7957c90c85c4c4f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-09-08T04:15:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e6c8b0aa624deb507094918b5dd689d9fea28070",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-07-29T00:24:40Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34ec83b058c32a19b62a15212995122c1ef79cdd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-07-27T03:47:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c6cbe460317484cb45daec0dbabfe4c1d0bf6cc8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-06-29T05:36:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9563ee68e845cc256cc371a6c76a750a4bab7c15",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-05-25T04:10:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6eb0c53e09bd552740dee0ede369f6b97d6983d5",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-04-27T03:41:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8898185c29290f52515bbd1ce53816181ce37c0f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-03-23T02:04:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "44ce3f31e18e9c70ec8210fe960fdb4941cd59f3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-03-03T04:28:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dadd7f25e31680f1c6bf61d2fb0b15794f425cd1",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-02-09T03:24:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ef9962f1d40abbb80a4fd4f023151fd28f891a6c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-11-17T04:34:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "23dbb5d218707805b74c9fe4f1e2525bcd21e689",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-11-03T03:57:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dbd8fefb0bbe96ed15f9af4518b078ae2c20e020",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-10-11T03:18:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "48c665ad12ba0e4d8068ba0784026c7488aa4746",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-09-08T03:45:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2692079b210682c63f12418ff613555efec218fd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-08-27T04:39:18Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a479e525582d09f315c2cf2a99075d6a798b535",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-08-26T05:43:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dbf8c9ab481e11b660a957257c73f55e2af83b20",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-06-23T06:52:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7bbf6f5f7cfa927286523a7681fd20b8489f0709",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-05-20T02:06:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d2358148183b3887b9d7285b6207a8345da2adc6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-05-06T02:48:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8273fb332de43e7929b7b78c13c72b32871f7394",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-03-17T01:43:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "729e1f713c3b6d526daa6cb8f7a3b3ad864c53e3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-02-10T03:44:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "310051defb85fec8581ace8b739ab7b18023db8a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-12-08T07:23:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f78490be294c347958f310e547582856b8aa8101",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-11-25T03:13:16Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "933ded7b599708ed26b7524add7bbce21e777805",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-11-18T05:34:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a436d254bc8d62e50be1fdb3d3e98981ab0e4c40",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-10-01T05:31:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a2c91ba89b76a3cf1df632ab7f84a608f5ba52a0",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-09-29T04:32:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "71197b6a12405d7a6e2067f725c387595bd9b3f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-08-17T04:00:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "940fdcfa7aa2ade09a1ec916dadeee01baa7787a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-07-08T04:08:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "aa17e50a1302fdb601a56e99b7b59f7abe5ff2a6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-06-30T05:22:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d61fb3a8f356c3e333e0108ac539c32aeadadfb3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-06-10T04:52:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "680aa992f10f6ca37a700d5cfacf18beac86911b",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-05-27T04:42:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5831401fd1681524b32992f6c485ef180ea84d2f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-05-21T03:33:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a9e4928aac63b18db3bc670661f8661133c3c205",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-04-23T02:47:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "29bd1c22d35ad8a27982fddbe11a84a124c24b40",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-03-25T02:45:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3653eec90aba773ebd66183fb867c77af21b2c7c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-02-13T04:02:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1a55d7d048c62c64c3f43734dfaa4bc0d776a035",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.6 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-01-28T05:08:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "26d9f929904015cc5c269418e0b86c522a8f8846",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.5 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-19T06:21:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7fcdd149d2e2f6013c78a965b8fab2bbe011de4f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.4 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-11T03:56:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9332192a57fae1d717780486eabfd2d661e3b7e8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-04T03:23:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7587e9a7d09ea0a2ae16f6628918c1bd18df2baa",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-11-19T04:29:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "782aa3876f354b8d04fbf1124c4aa440cec9d199",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-10-28T06:39:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a4eca7a227e4dd97ed4356f708f0f481ab5164cb",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-10-17T06:09:31Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 100,
      "commits_last_year": 20,
      "latest_release_at": "2026-07-15T02:36:42Z",
      "latest_release_tag": "8.8.0",
      "releases_from_tags": true,
      "days_since_last_push": 6,
      "active_weeks_last_year": 16,
      "days_since_latest_release": 6,
      "mean_days_between_releases": 26.7
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "tinymce",
          "exists": true,
          "license": "SEE LICENSE IN license.md",
          "keywords": [
            "wysiwyg",
            "tinymce",
            "richtext",
            "javascript",
            "html",
            "text",
            "rich editor",
            "rich text editor",
            "rte",
            "rich text",
            "contenteditable",
            "editing"
          ],
          "ecosystem": "npm",
          "matches_repo": false,
          "registry_url": "https://www.npmjs.com/package/tinymce",
          "is_deprecated": false,
          "latest_version": "8.8.0",
          "repository_url": "https://github.com/tinymce/tinymce",
          "versions_count": 218,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 3,
          "monthly_downloads": 4489241,
          "first_published_at": "2014-05-06T10:59:32.298000Z",
          "latest_published_at": "2026-07-15T02:38:50.723000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 6
        },
        {
          "name": "tinymce/tinymce",
          "exists": true,
          "license": "SEE LICENSE IN license.md",
          "keywords": [
            "text",
            "javascript",
            "wysiwyg",
            "tinymce",
            "html",
            "editing",
            "richtext",
            "contenteditable",
            "rte",
            "rich editor",
            "rich text editor",
            "rich text"
          ],
          "ecosystem": "packagist",
          "matches_repo": true,
          "registry_url": "https://packagist.org/packages/tinymce/tinymce",
          "is_deprecated": false,
          "latest_version": "8.8.0",
          "repository_url": "https://github.com/tinymce/tinymce-dist",
          "versions_count": 243,
          "total_downloads": 8167016,
          "dependents_count": 115,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": 173352,
          "first_published_at": null,
          "latest_published_at": "2026-07-15T02:36:42Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 6
        }
      ]
    },
    "popularity": {
      "forks": 158,
      "stars": 170,
      "watchers": 24,
      "fork_history": {
        "days": [
          {
            "date": "2014-09-16",
            "count": 1
          },
          {
            "date": "2014-11-03",
            "count": 1
          },
          {
            "date": "2014-11-20",
            "count": 1
          },
          {
            "date": "2014-11-25",
            "count": 1
          },
          {
            "date": "2015-02-05",
            "count": 1
          },
          {
            "date": "2015-03-15",
            "count": 1
          },
          {
            "date": "2015-03-27",
            "count": 1
          },
          {
            "date": "2015-04-24",
            "count": 1
          },
          {
            "date": "2015-04-27",
            "count": 1
          },
          {
            "date": "2015-05-02",
            "count": 1
          },
          {
            "date": "2015-05-19",
            "count": 1
          },
          {
            "date": "2015-06-06",
            "count": 1
          },
          {
            "date": "2015-06-09",
            "count": 1
          },
          {
            "date": "2015-06-25",
            "count": 1
          },
          {
            "date": "2015-07-27",
            "count": 1
          },
          {
            "date": "2015-07-28",
            "count": 1
          },
          {
            "date": "2015-08-17",
            "count": 1
          },
          {
            "date": "2015-08-24",
            "count": 1
          },
          {
            "date": "2015-09-11",
            "count": 1
          },
          {
            "date": "2015-10-02",
            "count": 1
          },
          {
            "date": "2015-10-09",
            "count": 1
          },
          {
            "date": "2015-10-15",
            "count": 1
          },
          {
            "date": "2015-11-19",
            "count": 1
          },
          {
            "date": "2015-12-18",
            "count": 1
          },
          {
            "date": "2016-02-22",
            "count": 1
          },
          {
            "date": "2016-03-23",
            "count": 1
          },
          {
            "date": "2016-03-25",
            "count": 1
          },
          {
            "date": "2016-03-30",
            "count": 1
          },
          {
            "date": "2016-04-06",
            "count": 1
          },
          {
            "date": "2016-04-15",
            "count": 1
          },
          {
            "date": "2016-04-19",
            "count": 1
          },
          {
            "date": "2016-05-27",
            "count": 1
          },
          {
            "date": "2016-06-10",
            "count": 1
          },
          {
            "date": "2016-07-05",
            "count": 1
          },
          {
            "date": "2016-07-07",
            "count": 1
          },
          {
            "date": "2016-07-11",
            "count": 2
          },
          {
            "date": "2016-08-02",
            "count": 1
          },
          {
            "date": "2016-10-22",
            "count": 1
          },
          {
            "date": "2016-12-19",
            "count": 1
          },
          {
            "date": "2017-02-27",
            "count": 1
          },
          {
            "date": "2017-07-12",
            "count": 1
          },
          {
            "date": "2017-10-03",
            "count": 1
          },
          {
            "date": "2017-10-05",
            "count": 1
          },
          {
            "date": "2017-10-07",
            "count": 1
          },
          {
            "date": "2017-10-10",
            "count": 1
          },
          {
            "date": "2017-11-29",
            "count": 1
          },
          {
            "date": "2017-12-07",
            "count": 1
          },
          {
            "date": "2017-12-21",
            "count": 1
          },
          {
            "date": "2018-01-30",
            "count": 1
          },
          {
            "date": "2018-03-07",
            "count": 1
          },
          {
            "date": "2018-03-29",
            "count": 1
          },
          {
            "date": "2018-04-03",
            "count": 1
          },
          {
            "date": "2018-04-09",
            "count": 1
          },
          {
            "date": "2018-04-16",
            "count": 1
          },
          {
            "date": "2018-07-11",
            "count": 1
          },
          {
            "date": "2018-07-16",
            "count": 1
          },
          {
            "date": "2018-08-06",
            "count": 1
          },
          {
            "date": "2018-08-20",
            "count": 1
          },
          {
            "date": "2018-08-23",
            "count": 2
          },
          {
            "date": "2018-09-19",
            "count": 1
          },
          {
            "date": "2018-09-21",
            "count": 1
          },
          {
            "date": "2018-10-04",
            "count": 1
          },
          {
            "date": "2018-10-30",
            "count": 1
          },
          {
            "date": "2018-11-21",
            "count": 1
          },
          {
            "date": "2018-11-28",
            "count": 1
          },
          {
            "date": "2018-12-11",
            "count": 1
          },
          {
            "date": "2018-12-19",
            "count": 1
          },
          {
            "date": "2019-01-09",
            "count": 2
          },
          {
            "date": "2019-01-25",
            "count": 1
          },
          {
            "date": "2019-02-05",
            "count": 1
          },
          {
            "date": "2019-02-10",
            "count": 1
          },
          {
            "date": "2019-02-11",
            "count": 1
          },
          {
            "date": "2019-03-15",
            "count": 1
          },
          {
            "date": "2019-03-30",
            "count": 1
          },
          {
            "date": "2019-04-04",
            "count": 1
          },
          {
            "date": "2019-04-09",
            "count": 1
          },
          {
            "date": "2019-04-29",
            "count": 1
          },
          {
            "date": "2019-05-09",
            "count": 1
          },
          {
            "date": "2019-06-14",
            "count": 1
          },
          {
            "date": "2019-07-12",
            "count": 1
          },
          {
            "date": "2019-08-31",
            "count": 1
          },
          {
            "date": "2019-10-09",
            "count": 1
          },
          {
            "date": "2019-10-11",
            "count": 1
          },
          {
            "date": "2019-11-07",
            "count": 1
          },
          {
            "date": "2019-11-18",
            "count": 1
          },
          {
            "date": "2019-12-28",
            "count": 1
          },
          {
            "date": "2020-01-24",
            "count": 2
          },
          {
            "date": "2020-02-07",
            "count": 1
          },
          {
            "date": "2020-04-02",
            "count": 1
          },
          {
            "date": "2020-04-10",
            "count": 1
          },
          {
            "date": "2020-04-15",
            "count": 1
          },
          {
            "date": "2020-05-04",
            "count": 1
          },
          {
            "date": "2020-05-15",
            "count": 1
          },
          {
            "date": "2020-05-19",
            "count": 1
          },
          {
            "date": "2020-06-01",
            "count": 1
          },
          {
            "date": "2020-06-12",
            "count": 1
          },
          {
            "date": "2020-06-21",
            "count": 1
          },
          {
            "date": "2020-07-01",
            "count": 1
          },
          {
            "date": "2020-07-09",
            "count": 1
          },
          {
            "date": "2020-07-27",
            "count": 1
          },
          {
            "date": "2020-10-14",
            "count": 1
          },
          {
            "date": "2020-11-09",
            "count": 1
          },
          {
            "date": "2020-12-11",
            "count": 1
          },
          {
            "date": "2020-12-14",
            "count": 1
          },
          {
            "date": "2021-01-18",
            "count": 1
          },
          {
            "date": "2021-01-31",
            "count": 1
          },
          {
            "date": "2021-02-06",
            "count": 1
          },
          {
            "date": "2021-02-20",
            "count": 1
          },
          {
            "date": "2021-03-03",
            "count": 1
          },
          {
            "date": "2021-03-19",
            "count": 1
          },
          {
            "date": "2021-04-08",
            "count": 1
          },
          {
            "date": "2021-05-14",
            "count": 1
          },
          {
            "date": "2021-05-21",
            "count": 1
          },
          {
            "date": "2021-06-03",
            "count": 1
          },
          {
            "date": "2021-06-15",
            "count": 1
          },
          {
            "date": "2021-06-29",
            "count": 1
          },
          {
            "date": "2021-09-01",
            "count": 1
          },
          {
            "date": "2021-09-27",
            "count": 1
          },
          {
            "date": "2021-10-06",
            "count": 1
          },
          {
            "date": "2021-11-21",
            "count": 1
          },
          {
            "date": "2021-11-23",
            "count": 1
          },
          {
            "date": "2021-11-25",
            "count": 1
          },
          {
            "date": "2022-01-11",
            "count": 1
          },
          {
            "date": "2022-01-23",
            "count": 1
          },
          {
            "date": "2022-02-16",
            "count": 1
          },
          {
            "date": "2022-03-22",
            "count": 1
          },
          {
            "date": "2022-04-19",
            "count": 1
          },
          {
            "date": "2022-06-14",
            "count": 1
          },
          {
            "date": "2022-07-12",
            "count": 1
          },
          {
            "date": "2022-07-26",
            "count": 1
          },
          {
            "date": "2022-08-01",
            "count": 1
          },
          {
            "date": "2022-08-08",
            "count": 1
          },
          {
            "date": "2022-08-17",
            "count": 1
          },
          {
            "date": "2022-08-22",
            "count": 2
          },
          {
            "date": "2022-09-02",
            "count": 1
          },
          {
            "date": "2022-09-09",
            "count": 1
          },
          {
            "date": "2022-11-09",
            "count": 1
          },
          {
            "date": "2023-02-22",
            "count": 1
          },
          {
            "date": "2023-03-10",
            "count": 1
          },
          {
            "date": "2023-03-26",
            "count": 1
          },
          {
            "date": "2023-04-28",
            "count": 1
          },
          {
            "date": "2024-08-06",
            "count": 1
          },
          {
            "date": "2025-05-29",
            "count": 1
          },
          {
            "date": "2025-08-28",
            "count": 1
          },
          {
            "date": "2025-08-29",
            "count": 1
          },
          {
            "date": "2025-09-19",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 151,
        "total_forks": 158
      },
      "star_history": {
        "days": [
          {
            "date": "2014-05-08",
            "count": 1
          },
          {
            "date": "2014-05-15",
            "count": 1
          },
          {
            "date": "2014-05-16",
            "count": 1
          },
          {
            "date": "2014-05-19",
            "count": 1
          },
          {
            "date": "2014-05-31",
            "count": 1
          },
          {
            "date": "2014-06-25",
            "count": 1
          },
          {
            "date": "2014-07-23",
            "count": 1
          },
          {
            "date": "2014-08-15",
            "count": 1
          },
          {
            "date": "2014-08-18",
            "count": 1
          },
          {
            "date": "2014-10-20",
            "count": 1
          },
          {
            "date": "2014-10-27",
            "count": 1
          },
          {
            "date": "2014-11-04",
            "count": 1
          },
          {
            "date": "2014-11-21",
            "count": 1
          },
          {
            "date": "2014-12-29",
            "count": 1
          },
          {
            "date": "2015-01-20",
            "count": 1
          },
          {
            "date": "2015-02-19",
            "count": 1
          },
          {
            "date": "2015-03-17",
            "count": 1
          },
          {
            "date": "2015-06-10",
            "count": 1
          },
          {
            "date": "2015-06-29",
            "count": 1
          },
          {
            "date": "2015-07-08",
            "count": 1
          },
          {
            "date": "2015-07-28",
            "count": 1
          },
          {
            "date": "2015-08-07",
            "count": 1
          },
          {
            "date": "2015-12-01",
            "count": 1
          },
          {
            "date": "2015-12-11",
            "count": 2
          },
          {
            "date": "2016-01-04",
            "count": 1
          },
          {
            "date": "2016-01-07",
            "count": 1
          },
          {
            "date": "2016-01-13",
            "count": 1
          },
          {
            "date": "2016-02-24",
            "count": 1
          },
          {
            "date": "2016-04-21",
            "count": 2
          },
          {
            "date": "2016-05-18",
            "count": 1
          },
          {
            "date": "2016-09-05",
            "count": 1
          },
          {
            "date": "2016-10-25",
            "count": 1
          },
          {
            "date": "2017-01-10",
            "count": 1
          },
          {
            "date": "2017-01-11",
            "count": 1
          },
          {
            "date": "2017-02-14",
            "count": 1
          },
          {
            "date": "2017-02-21",
            "count": 1
          },
          {
            "date": "2017-03-05",
            "count": 1
          },
          {
            "date": "2017-03-30",
            "count": 1
          },
          {
            "date": "2017-05-09",
            "count": 1
          },
          {
            "date": "2017-06-25",
            "count": 1
          },
          {
            "date": "2017-09-10",
            "count": 1
          },
          {
            "date": "2017-12-21",
            "count": 1
          },
          {
            "date": "2017-12-27",
            "count": 1
          },
          {
            "date": "2018-01-03",
            "count": 1
          },
          {
            "date": "2018-01-14",
            "count": 1
          },
          {
            "date": "2018-02-20",
            "count": 1
          },
          {
            "date": "2018-03-20",
            "count": 1
          },
          {
            "date": "2018-03-26",
            "count": 1
          },
          {
            "date": "2018-04-11",
            "count": 1
          },
          {
            "date": "2018-05-17",
            "count": 1
          },
          {
            "date": "2018-06-08",
            "count": 2
          },
          {
            "date": "2018-06-15",
            "count": 1
          },
          {
            "date": "2018-06-29",
            "count": 1
          },
          {
            "date": "2018-07-31",
            "count": 2
          },
          {
            "date": "2018-08-12",
            "count": 1
          },
          {
            "date": "2018-09-01",
            "count": 1
          },
          {
            "date": "2018-09-07",
            "count": 1
          },
          {
            "date": "2018-09-27",
            "count": 1
          },
          {
            "date": "2018-11-03",
            "count": 1
          },
          {
            "date": "2019-01-09",
            "count": 1
          },
          {
            "date": "2019-02-18",
            "count": 1
          },
          {
            "date": "2019-02-28",
            "count": 1
          },
          {
            "date": "2019-03-08",
            "count": 1
          },
          {
            "date": "2019-03-15",
            "count": 1
          },
          {
            "date": "2019-04-07",
            "count": 1
          },
          {
            "date": "2019-04-14",
            "count": 1
          },
          {
            "date": "2019-04-18",
            "count": 1
          },
          {
            "date": "2019-05-30",
            "count": 1
          },
          {
            "date": "2019-05-31",
            "count": 1
          },
          {
            "date": "2019-06-12",
            "count": 1
          },
          {
            "date": "2019-06-14",
            "count": 1
          },
          {
            "date": "2019-08-01",
            "count": 1
          },
          {
            "date": "2019-08-29",
            "count": 1
          },
          {
            "date": "2019-09-04",
            "count": 1
          },
          {
            "date": "2019-09-17",
            "count": 1
          },
          {
            "date": "2019-10-11",
            "count": 1
          },
          {
            "date": "2019-10-15",
            "count": 1
          },
          {
            "date": "2019-11-01",
            "count": 1
          },
          {
            "date": "2019-11-02",
            "count": 1
          },
          {
            "date": "2019-12-09",
            "count": 1
          },
          {
            "date": "2020-01-04",
            "count": 1
          },
          {
            "date": "2020-01-17",
            "count": 1
          },
          {
            "date": "2020-01-19",
            "count": 1
          },
          {
            "date": "2020-01-23",
            "count": 1
          },
          {
            "date": "2020-01-24",
            "count": 1
          },
          {
            "date": "2020-03-16",
            "count": 1
          },
          {
            "date": "2020-04-01",
            "count": 2
          },
          {
            "date": "2020-04-02",
            "count": 1
          },
          {
            "date": "2020-04-23",
            "count": 1
          },
          {
            "date": "2020-05-14",
            "count": 1
          },
          {
            "date": "2020-05-22",
            "count": 2
          },
          {
            "date": "2020-06-16",
            "count": 1
          },
          {
            "date": "2020-07-26",
            "count": 1
          },
          {
            "date": "2020-09-22",
            "count": 1
          },
          {
            "date": "2020-10-05",
            "count": 1
          },
          {
            "date": "2020-11-09",
            "count": 1
          },
          {
            "date": "2020-11-21",
            "count": 1
          },
          {
            "date": "2020-12-23",
            "count": 1
          },
          {
            "date": "2021-01-11",
            "count": 1
          },
          {
            "date": "2021-01-31",
            "count": 1
          },
          {
            "date": "2021-02-02",
            "count": 1
          },
          {
            "date": "2021-02-05",
            "count": 1
          },
          {
            "date": "2021-03-06",
            "count": 1
          },
          {
            "date": "2021-03-17",
            "count": 1
          },
          {
            "date": "2021-04-08",
            "count": 1
          },
          {
            "date": "2021-04-21",
            "count": 1
          },
          {
            "date": "2021-04-22",
            "count": 1
          },
          {
            "date": "2021-05-06",
            "count": 1
          },
          {
            "date": "2021-07-12",
            "count": 1
          },
          {
            "date": "2021-07-13",
            "count": 1
          },
          {
            "date": "2021-07-14",
            "count": 1
          },
          {
            "date": "2021-07-17",
            "count": 1
          },
          {
            "date": "2021-07-21",
            "count": 1
          },
          {
            "date": "2021-07-27",
            "count": 1
          },
          {
            "date": "2021-08-16",
            "count": 1
          },
          {
            "date": "2021-08-17",
            "count": 1
          },
          {
            "date": "2021-09-24",
            "count": 1
          },
          {
            "date": "2021-10-05",
            "count": 1
          },
          {
            "date": "2021-11-21",
            "count": 1
          },
          {
            "date": "2021-11-23",
            "count": 1
          },
          {
            "date": "2021-12-13",
            "count": 1
          },
          {
            "date": "2022-01-29",
            "count": 1
          },
          {
            "date": "2022-03-03",
            "count": 1
          },
          {
            "date": "2022-03-20",
            "count": 1
          },
          {
            "date": "2022-04-21",
            "count": 1
          },
          {
            "date": "2022-05-28",
            "count": 1
          },
          {
            "date": "2022-06-07",
            "count": 1
          },
          {
            "date": "2022-07-01",
            "count": 1
          },
          {
            "date": "2022-07-04",
            "count": 1
          },
          {
            "date": "2022-09-01",
            "count": 1
          },
          {
            "date": "2022-09-28",
            "count": 1
          },
          {
            "date": "2022-12-04",
            "count": 1
          },
          {
            "date": "2023-02-22",
            "count": 1
          },
          {
            "date": "2023-02-25",
            "count": 1
          },
          {
            "date": "2023-04-21",
            "count": 1
          },
          {
            "date": "2023-05-02",
            "count": 1
          },
          {
            "date": "2023-05-27",
            "count": 1
          },
          {
            "date": "2023-05-31",
            "count": 1
          },
          {
            "date": "2023-06-26",
            "count": 1
          },
          {
            "date": "2023-08-13",
            "count": 1
          },
          {
            "date": "2023-09-08",
            "count": 1
          },
          {
            "date": "2023-10-16",
            "count": 1
          },
          {
            "date": "2023-10-23",
            "count": 1
          },
          {
            "date": "2023-12-09",
            "count": 1
          },
          {
            "date": "2024-02-25",
            "count": 1
          },
          {
            "date": "2024-03-25",
            "count": 1
          },
          {
            "date": "2024-04-11",
            "count": 1
          },
          {
            "date": "2024-07-07",
            "count": 1
          },
          {
            "date": "2024-10-25",
            "count": 1
          },
          {
            "date": "2024-10-29",
            "count": 1
          },
          {
            "date": "2024-12-27",
            "count": 1
          },
          {
            "date": "2025-02-24",
            "count": 1
          },
          {
            "date": "2025-02-28",
            "count": 1
          },
          {
            "date": "2025-06-09",
            "count": 1
          },
          {
            "date": "2025-07-03",
            "count": 1
          },
          {
            "date": "2025-08-29",
            "count": 1
          },
          {
            "date": "2025-10-20",
            "count": 1
          },
          {
            "date": "2025-12-17",
            "count": 1
          },
          {
            "date": "2026-01-12",
            "count": 1
          },
          {
            "date": "2026-01-15",
            "count": 1
          },
          {
            "date": "2026-02-06",
            "count": 1
          },
          {
            "date": "2026-02-21",
            "count": 1
          },
          {
            "date": "2026-06-19",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 169,
        "total_stars": 170
      },
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "toolchain_manifests": [],
      "largest_source_bytes": 1895997,
      "source_files_sampled": 221,
      "oversized_source_files": 22,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "composer.json",
        "package.json"
      ],
      "advisories": {
        "error": "No resolved dependencies to assess",
        "scope": "repository_graph",
        "source": null,
        "findings": [],
        "collected": false,
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm",
        "packagist"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [],
        "collected": true,
        "truncated": false,
        "total_count": 0,
        "direct_count": 0,
        "indirect_count": 0
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 1,
        "merged_prs": 0,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 12
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "spocke",
          "commits": 74,
          "avatar_url": "https://avatars.githubusercontent.com/u/115879?v=4"
        },
        {
          "type": "User",
          "login": "jhaines",
          "commits": 1,
          "avatar_url": "https://avatars.githubusercontent.com/u/2252638?v=4"
        }
      ],
      "contributors_sampled": 2,
      "top_contributor_share": 0.987
    },
    "quality_signals": {
      "has_ci": false,
      "has_tests": false,
      "ci_workflows": [],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/30 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 3 contributing companies or organizations -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": null,
            "reason": "no workflows found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 9,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 5,
            "reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": null,
            "reason": "no dependencies found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": null,
            "reason": "No tokens found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "23137d1b2f95cdd68f304292685157ba090e7518",
        "ran_at": "2026-07-21T20:25:32Z",
        "aggregate_score": 3.5,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/tinymce/tinymce-dist",
    "host": "github.com",
    "name": "tinymce-dist",
    "owner": "tinymce"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 48,
      "inputs": {
        "security": 35,
        "vitality": 74,
        "community": 61,
        "governance": 45,
        "engineering": 21
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 74,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 64,
            "inputs": {
              "commits_last_year": 20,
              "human_commit_share": 1,
              "days_since_last_push": 6,
              "active_weeks_last_year": 16
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 6 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "16/52 weeks with commits",
                "points": 11.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 16
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "20 commits in the last year",
                "points": 11.9,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 20
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 5,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 88,
            "inputs": {
              "releases_count": 100,
              "latest_release_tag": "8.8.0",
              "releases_from_tags": true,
              "days_since_latest_release": 6,
              "mean_days_between_releases": 26.7
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "100 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 100
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 6 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~26.7 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 26.7
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "maintained",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 6,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "last human commit 6 days ago",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_maintained",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 61,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "moderate",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 62,
            "inputs": {
              "forks": 158,
              "stars": 170,
              "watchers": 24,
              "growth_state": "organic",
              "growth_factor_pct": 100
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "170 stars",
                "points": 36.1,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 170
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "158 forks",
                "points": 18.3,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 158
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "24 watchers",
                "points": 7.6,
                "status": "partial",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 24
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "at_risk",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file present, not a recognized license",
                "points": 16.9,
                "status": "partial",
                "details": [
                  {
                    "code": "license_custom",
                    "params": {}
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "good",
            "name": "Ecosystem adoption (downloads)",
            "note": null,
            "notes": [],
            "value": 84,
            "inputs": {
              "packages": [
                "tinymce/tinymce"
              ],
              "dependents": 115,
              "ecosystems": "packagist",
              "total_downloads": 8167016,
              "monthly_downloads": 173352
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "173,352 downloads/month across packagist",
                "points": 69.9,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 173352,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "115 packages depend on it",
                "points": 13.8,
                "status": "partial",
                "details": [
                  {
                    "code": "registry_dependents",
                    "params": {
                      "count": 115
                    }
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 45,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 22,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 2,
              "top_contributor_share": 0.987
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 99% of commits",
                "points": 0.3,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 99
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "2 contributors",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 3 contributing companies or organizations -- score normalized to 10",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 12
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "0/12 decided PRs merged",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 0,
                      "decided": 12
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/30 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "good",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 74,
            "inputs": {
              "followers": 418,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "tinymce",
              "public_repos": 102,
              "account_age_days": 6173
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "418 followers of tinymce",
                "points": 18.9,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 418,
                      "login": "tinymce"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "102 public repos, account ~16 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 102
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 16
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "tinymce/tinymce"
              ],
              "ecosystems": "packagist",
              "any_deprecated": false,
              "min_days_since_publish": 6
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on packagist",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 6 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "243 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 243
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "critical",
        "name": "Engineering Quality",
        "value": 21,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "critical",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_ci": false,
              "has_tests": false,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "tinymce"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "1 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 35,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "dangerous_workflow",
                    "packaging",
                    "pinned_dependencies",
                    "signed_releases",
                    "token_permissions"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 35,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 12,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 6,
              "scorecard_aggregate": 3.5
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/30 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 3 contributing companies or organizations -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no workflows found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.2,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 3.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "No tokens found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 1
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 10,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "0 of 100 human commits state their intent (structured subject or explanatory body)",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 0,
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "critical",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_pinned_dependencies"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_nix": false,
              "has_tests": false,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [],
              "agent_commit_share": 0,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no agent-authored commits among the last 100",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_authored_commits",
                    "params": {
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no automated dependency updates observed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_dependency_automation",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 1895997,
              "source_files_sampled": 221,
              "oversized_source_files": 22
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "22/221 source files over 60KB",
                "points": 49.5,
                "status": "partial",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 221,
                      "oversized": 22
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring",
    "deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-21T20:25:38.248671Z",
  "schema_version": "0.23.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/t/tinymce/tinymce-dist.svg",
  "full_name": "tinymce/tinymce-dist",
  "license_state": "custom",
  "license_spdx": null
}

Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.

Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.23.0 — vollständige Methodik · Metriken-Wiki.

Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistikennpm, Packagist.