Registro público
Informe de salud del softwareesquema 0.23.0 · métricas 1.13.0 · 2026-07-21 20:25 UTC

tinymce / tinymce-dist

Official TinyMCE repository for production usage in package managers

JavaScript · CSSLicencia propia★ 170 estrellas⑂ 158 forksdesde may 2014Ver en GitHub ↗

tinymce/tinymce-dist tiene un índice de salud de 48 sobre 100, lo que lo sitúa en la banda En riesgo. Su puntuación más alta es Vitality (74/100) y la más baja, AI Readiness (10/100). Se actualizó por última vez hace 6 días. Una sola persona concentra la mayor parte del trabajo reciente.

48
global / 100
En riesgo

Índice de salud del software

Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.

48
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
VitalidadComunidad yAdopciónSostenibilidady GobernanzaCalidad deIngenieríaSeguridadPreparaciónpara IA

Perfil de puntuación

Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.

Titularidad

TinyOrganización
418 seguidores102 repositorios públicosdesde ago 2009

Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.

Ecosistemas de paquetes

RegistroPaqueteVersiónDescargas / mesVersionesÚltima publicaciónEtiquetas
npmtinymceapunta a otro repositorio; no se puntúa8.8.04.489.241218hace 6 díaswysiwygtinymcerichtextjavascripthtmltextrich-editorrich-text-editorrterich-textcontenteditableediting
Packagisttinymce/tinymce8.8.0173.352243hace 6 díastextjavascriptwysiwygtinymcehtmleditingrichtextcontenteditablerterich-editorrich-text-editorrich-text

Métricas por categoría

Vitalidad

¿Está vivo el proyecto: se escribe código y se publican versiones?

74Bueno · 22% del índice global
Cómo se puntúa
36/36Recencia de push — último push hace 6 días
11.1/36Cadencia de commits — 16/52 semanas con commits
11.9/18Volumen de commits — 20 commits en el último año
5/10OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
Datos de entrada utilizados
commits_last_year20
human_commit_share1
days_since_last_push6
active_weeks_last_year16
Cómo se puntúa
16.2/27Publica versiones — 100 etiquetas de versión (sin releases de GitHub)
36/36Recencia de las versiones — última versión hace 6 días
27/27Cadencia de publicación — una versión cada ~26,7 días
0/10OpenSSF Scorecard: Signed-Releases — sin datos
Datos de entrada utilizados
releases_count100
latest_release_tag8.8.0
releases_from_tags
days_since_latest_release6
mean_days_between_releases26,7
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.

Comunidad y Adopción

¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?

61Moderado · 18% del índice global
Cómo se puntúa
36.1/60Estrellas — 170 estrellas
18.3/25Forks — 158 forks
7.6/15Observadores — 24 observadores
Datos de entrada utilizados
forks158
stars170
watchers24
growth_stateorganic
growth_factor_pct100
Cómo se puntúa
22.5/22.5README
16.9/22.5Licencia — archivo de licencia presente, no es una licencia reconocida
0/18Guía CONTRIBUTING
0/13.5Código de conducta
0/7.2Plantilla de issues
0/6.3Plantilla de PR
Datos de entrada utilizados
has_readme
has_license
has_contributingno
has_issue_templateno
has_code_of_conductno
has_pull_request_templateno
Cómo se puntúa
69.9/80Descargas mensuales — 173.352 descargas/mes en packagist
13.8/20Dependientes en el registro — 115 paquetes dependen de él
Datos de entrada utilizados
packagestinymce/tinymce
dependents115
ecosystemspackagist
total_downloads8.167.016
monthly_downloads173.352

Sostenibilidad y Gobernanza

¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?

45En riesgo · 24% del índice global
Cómo se puntúa
9/54Factor bus — la mitad de los commits recae en 1 contribuyente(s)
0.3/22.5Distribución de commits — el principal contribuyente firma el 99% de los commits
2.7/13.5Amplitud de contribuyentes — 2 contribuyentes
10/10OpenSSF Scorecard: Contributors — project has 3 contributing companies or organizations -- score normalized to 10
Datos de entrada utilizados
bus_factor1
contributors_sampled2
top_contributor_share0,987
Cómo se puntúa
0/46.8Resolución de issues — sin issues o sin datos
0/38.3Aceptación de PR — 0/12 PR decididos fusionados
0/15OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0
Datos de entrada utilizados
merged_prs0
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs12
Excluidos de la puntuación (sin datos o no aplicable): Resolución de issues. Los pesos restantes se han renormalizado.
Cómo se puntúa
30/30Respaldo de la propiedad — propiedad de una organización
0/20Dominio verificado
18.9/25Alcance del propietario — 418 seguidores de tinymce
25/25Trayectoria — 102 repos públicos, cuenta de ~16 años
Datos de entrada utilizados
followers418
owner_typeOrganization
is_verified
owner_logintinymce
public_repos102
account_age_days6173
Cómo se puntúa
25/25Publicado y resoluble — 1 paquete(s) en packagist
35/35Recencia de publicación — última publicación hace 6 días
20/20Historial de versiones — 243 versiones en el registro
20/20No obsoleto — activo, ni obsoleto ni retirado
Datos de entrada utilizados
packagestinymce/tinymce
ecosystemspackagist
any_deprecatedno
min_days_since_publish6

Calidad de Ingeniería

¿Existen unas prácticas mínimas de ingeniería y documentación?

21Crítico · 20% del índice global
Cómo se puntúa
0/24Flujos de trabajo de CI
0/24Pruebas presentes
0/16Configuración de linter
0/9.6Hooks de pre-commit
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — sin datos
Datos de entrada utilizados
has_cino
has_testsno
has_editorconfigno
has_linter_configno
has_precommit_configno
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: CI-Tests. Los pesos restantes se han renormalizado.

Documentación

50Moderado
Cómo se puntúa
30/30README
0/25Directorio de documentación
0/15Sitio de documentación / página del proyecto
10/10Descripción del repositorio
10/10Topics — 1 topics
0/10Wiki
Datos de entrada utilizados
topicstinymce
has_wikino
homepage
has_readme
has_docs_dirno
has_description

Seguridad

¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?

35En riesgo · 16% del índice global
Cómo se puntúa
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
0/2.5CI-Tests — sin datos
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/30 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 3 contributing companies or organizations -- score normalized to 10
0/10Dangerous-Workflow — sin datos
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.2/2.5Licencia — license file detected
3.8/7.5Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
0/5Packaging — sin datos
0/5Pinned-Dependencies — sin datos
0/5SAST — no SAST tool detected
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — sin datos
0/7.5Token-Permissions — sin datos
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Datos de entrada utilizados
sourceopenssf_scorecard
checks_evaluated12
scorecard_versionv5.5.0
checks_inconclusive6
scorecard_aggregate3,5
Excluidos de la puntuación (sin datos o no aplicable): ci_tests, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Los pesos restantes se han renormalizado.

Preparación para IA

¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.

10Crítico · 0% del índice global
Cómo se puntúa
0/45Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor
0/15Documentación legible por máquinas (llms.txt)
0/40Historial de commits legible — 0 de 100 commits humanos declaran su intención (asunto estructurado o cuerpo explicativo)
Datos de entrada utilizados
has_llms_txtno
legible_history_share0
agent_instruction_files
agent_instruction_max_bytes
Cómo se puntúa
0/18Arranque con un solo comando
0/22Pruebas automatizadas
0/11Configuración de lint / formato
0/11Verificación estática de tipos
0/10Entorno reproducible
0/10Práctica demostrada con agentes — ningún commit con autoría de agente entre los últimos 100
0/8Mantenimiento automatizado — no se observan actualizaciones automáticas de dependencias
0/10OpenSSF Scorecard: Pinned-Dependencies — sin datos
Datos de entrada utilizados
has_nixno
has_testsno
lockfiles
has_dockerfileno
typed_languageno
bootstrap_files
has_devcontainerno
has_linter_configno
typecheck_configs
agent_commit_share0
toolchain_manifests
dependency_bot_commit_share0
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Pinned-Dependencies. Los pesos restantes se han renormalizado.
Cómo se puntúa
0/45Código verificable por tipos — JavaScript sin configuración de verificación de tipos
49.5/55Tamaños de archivo manejables — 22/221 archivos fuente de más de 60 KB
Datos de entrada utilizados
primary_languageJavaScript
largest_source_bytes1.895.997
source_files_sampled221
oversized_source_files22

Datos clave

170estrellas de GitHub
2contribuidores
20commits en los últimos 12 meses
6días desde el último push
100versiones publicadas
1factor bus
0issues abiertas
npm, Packagistecosistemas de paquetes

Advertencias de recopilación de datos

  • npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring
  • deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead

Más detalle

Historial de estrellas y forks 170 ★ / 158 ⇿
170Estrellas
158Forks
98Versiones

Cuándo se añadió cada estrella y fork, recopilado de GitHub y agrupado por día. El crecimiento acumulado se sitúa justo encima de las adiciones diarias que lo componen, de modo que ambos se leen en conjunto: la acumulación orgánica sostenida no se parece en nada a un pico abrupto y efímero. Cuando esa diferencia es medible, se informa como autenticidad del crecimiento.

0408012016020016915142014-052020-052026-06
Mayor 3Menor 30Parche 65

Cada punto abarca 12 días.

OpenSSF Scorecard 3.5 / 10
3.5agregado

Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).Scorecard v5.5.0 · 2026-07-21 20:25 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
n/dCI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/30 approved changesets -- score normalized to 0
10Contributorsproject has 3 contributing companies or organizations -- score normalized to 10
n/dDangerous-Workflowno workflows found
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
9Licenselicense file detected
5Maintained6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
n/dPackagingpackaging workflow not detected
n/dPinned-Dependenciesno dependencies found
0SASTno SAST tool detected
0Security-Policysecurity policy file not detected
n/dSigned-Releasesno releases found
n/dToken-PermissionsNo tokens found
10Vulnerabilities0 existing vulnerabilities detected
Todas las dependencias 0

Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 0 paquetes directos y 0 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.

RegistroPaqueteVersiónRelación
Avisos de dependencias sin evaluar

El cotejo de avisos no pudo ejecutarse para este informe: No resolved dependencies to assess

Informe JSON sin procesar legible por máquina
{
  "data": {
    "repo": {
      "topics": [
        "tinymce"
      ],
      "is_fork": false,
      "size_kb": 51419,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "CSS": 1221547,
        "JavaScript": 5155732,
        "TypeScript": 270304
      },
      "pushed_at": "2026-07-15T02:36:44Z",
      "created_at": "2014-05-06T10:57:12Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-15T02:36:49Z",
      "description": "Official TinyMCE repository for production usage in package managers",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": null,
      "default_branch": "master",
      "license_spdx_raw": "NOASSERTION",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript",
        "CSS"
      ]
    },
    "owner": {
      "blog": "https://www.tiny.cloud/",
      "name": "Tiny",
      "type": "Organization",
      "login": "tinymce",
      "company": null,
      "location": null,
      "followers": 418,
      "avatar_url": "https://avatars.githubusercontent.com/u/119815?v=4",
      "created_at": "2009-08-26T18:15:21Z",
      "is_verified": null,
      "public_repos": 102,
      "account_age_days": 6173
    },
    "license": {
      "state": "custom",
      "spdx_id": null,
      "raw_spdx": "NOASSERTION",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "8.8.0",
          "kind": "minor",
          "published_at": "2026-07-15T02:36:42Z"
        },
        {
          "tag": "8.7.0",
          "kind": "minor",
          "published_at": "2026-07-01T03:39:33Z"
        },
        {
          "tag": "8.6.0",
          "kind": "minor",
          "published_at": "2026-06-03T03:28:15Z"
        },
        {
          "tag": "8.5.1",
          "kind": "patch",
          "published_at": "2026-05-19T23:39:20Z"
        },
        {
          "tag": "8.5.0",
          "kind": "minor",
          "published_at": "2026-04-29T05:18:45Z"
        },
        {
          "tag": "8.4.0",
          "kind": "minor",
          "published_at": "2026-03-31T06:07:53Z"
        },
        {
          "tag": "8.3.2",
          "kind": "patch",
          "published_at": "2026-01-14T01:01:47Z"
        },
        {
          "tag": "8.3.1",
          "kind": "patch",
          "published_at": "2025-12-17T00:53:22Z"
        },
        {
          "tag": "8.3.0",
          "kind": "minor",
          "published_at": "2025-12-10T01:56:11Z"
        },
        {
          "tag": "8.2.2",
          "kind": "patch",
          "published_at": "2025-11-17T03:22:11Z"
        },
        {
          "tag": "8.2.1",
          "kind": "patch",
          "published_at": "2025-11-06T00:55:35Z"
        },
        {
          "tag": "8.2.0",
          "kind": "minor",
          "published_at": "2025-10-23T01:11:24Z"
        },
        {
          "tag": "8.1.2",
          "kind": "patch",
          "published_at": "2025-09-18T08:46:07Z"
        },
        {
          "tag": "8.1.1",
          "kind": "patch",
          "published_at": "2025-09-17T15:22:02Z"
        },
        {
          "tag": "8.1.0",
          "kind": "minor",
          "published_at": "2025-09-17T04:18:06Z"
        },
        {
          "tag": "8.0.2",
          "kind": "patch",
          "published_at": "2025-08-14T02:39:07Z"
        },
        {
          "tag": "8.0.1",
          "kind": "patch",
          "published_at": "2025-07-28T04:53:13Z"
        },
        {
          "tag": "8.0.0",
          "kind": "major",
          "published_at": "2025-07-23T02:30:15Z"
        },
        {
          "tag": "7.9.3",
          "kind": "patch",
          "published_at": "2026-05-19T23:38:56Z"
        },
        {
          "tag": "7.9.2",
          "kind": "patch",
          "published_at": "2026-02-11T03:44:54Z"
        },
        {
          "tag": "7.9.1",
          "kind": "patch",
          "published_at": "2025-05-29T02:22:36Z"
        },
        {
          "tag": "7.9.0",
          "kind": "minor",
          "published_at": "2025-05-15T01:47:37Z"
        },
        {
          "tag": "7.8.0",
          "kind": "minor",
          "published_at": "2025-04-09T02:06:27Z"
        },
        {
          "tag": "7.7.2",
          "kind": "patch",
          "published_at": "2025-03-19T03:36:58Z"
        },
        {
          "tag": "7.7.1",
          "kind": "patch",
          "published_at": "2025-03-05T00:36:32Z"
        },
        {
          "tag": "7.7.0",
          "kind": "minor",
          "published_at": "2025-02-20T08:31:02Z"
        },
        {
          "tag": "7.6.1",
          "kind": "patch",
          "published_at": "2025-01-22T03:57:00Z"
        },
        {
          "tag": "7.6.0",
          "kind": "minor",
          "published_at": "2024-12-11T04:56:37Z"
        },
        {
          "tag": "7.5.1",
          "kind": "patch",
          "published_at": "2024-11-13T03:16:27Z"
        },
        {
          "tag": "7.5.0",
          "kind": "minor",
          "published_at": "2024-11-06T03:04:46Z"
        },
        {
          "tag": "7.4.1",
          "kind": "patch",
          "published_at": "2024-10-10T05:50:45Z"
        },
        {
          "tag": "7.4.0",
          "kind": "minor",
          "published_at": "2024-10-09T05:28:03Z"
        },
        {
          "tag": "7.3.0",
          "kind": "minor",
          "published_at": "2024-08-07T06:30:33Z"
        },
        {
          "tag": "7.2.1",
          "kind": "patch",
          "published_at": "2024-07-03T05:25:26Z"
        },
        {
          "tag": "7.2.0",
          "kind": "minor",
          "published_at": "2024-06-19T06:08:58Z"
        },
        {
          "tag": "7.1.2",
          "kind": "patch",
          "published_at": "2024-06-05T05:16:22Z"
        },
        {
          "tag": "7.1.1",
          "kind": "patch",
          "published_at": "2024-05-22T08:18:50Z"
        },
        {
          "tag": "7.1.0",
          "kind": "minor",
          "published_at": "2024-05-08T05:24:56Z"
        },
        {
          "tag": "7.0.1",
          "kind": "patch",
          "published_at": "2024-04-10T07:29:34Z"
        },
        {
          "tag": "7.0.0",
          "kind": "major",
          "published_at": "2024-03-20T05:46:56Z"
        },
        {
          "tag": "6.8.6",
          "kind": "patch",
          "published_at": "2025-05-29T02:36:52Z"
        },
        {
          "tag": "6.8.5",
          "kind": "patch",
          "published_at": "2024-10-10T06:06:02Z"
        },
        {
          "tag": "6.8.4",
          "kind": "patch",
          "published_at": "2024-06-19T09:28:48Z"
        },
        {
          "tag": "6.8.3",
          "kind": "patch",
          "published_at": "2024-02-08T23:33:30Z"
        },
        {
          "tag": "6.8.2",
          "kind": "patch",
          "published_at": "2023-12-11T03:21:56Z"
        },
        {
          "tag": "6.8.1",
          "kind": "patch",
          "published_at": "2023-11-29T09:44:11Z"
        },
        {
          "tag": "6.8.0",
          "kind": "minor",
          "published_at": "2023-11-22T11:14:25Z"
        },
        {
          "tag": "6.7.3",
          "kind": "patch",
          "published_at": "2023-11-15T00:41:51Z"
        },
        {
          "tag": "6.7.2",
          "kind": "patch",
          "published_at": "2023-10-25T06:42:18Z"
        },
        {
          "tag": "6.7.1",
          "kind": "patch",
          "published_at": "2023-10-19T03:04:57Z"
        },
        {
          "tag": "6.7.0",
          "kind": "minor",
          "published_at": "2023-08-30T11:10:35Z"
        },
        {
          "tag": "6.6.2",
          "kind": "patch",
          "published_at": "2023-08-09T04:58:32Z"
        },
        {
          "tag": "6.6.1",
          "kind": "patch",
          "published_at": "2023-08-02T05:17:12Z"
        },
        {
          "tag": "6.6.0",
          "kind": "minor",
          "published_at": "2023-07-12T06:32:00Z"
        },
        {
          "tag": "6.5.1",
          "kind": "patch",
          "published_at": "2023-06-19T04:36:46Z"
        },
        {
          "tag": "6.5.0",
          "kind": "minor",
          "published_at": "2023-06-13T00:10:53Z"
        },
        {
          "tag": "6.4.2",
          "kind": "patch",
          "published_at": "2023-04-26T10:48:15Z"
        },
        {
          "tag": "6.4.1",
          "kind": "patch",
          "published_at": "2023-03-29T01:33:40Z"
        },
        {
          "tag": "6.4.0",
          "kind": "minor",
          "published_at": "2023-03-16T00:43:05Z"
        },
        {
          "tag": "6.3.2",
          "kind": "patch",
          "published_at": "2023-02-22T07:52:19Z"
        },
        {
          "tag": "6.3.1",
          "kind": "patch",
          "published_at": "2022-12-06T02:19:08Z"
        },
        {
          "tag": "6.3.0",
          "kind": "minor",
          "published_at": "2022-11-23T02:47:17Z"
        },
        {
          "tag": "6.2.0",
          "kind": "minor",
          "published_at": "2022-09-08T04:15:30Z"
        },
        {
          "tag": "6.1.2",
          "kind": "patch",
          "published_at": "2022-07-29T00:24:40Z"
        },
        {
          "tag": "6.1.1",
          "kind": "patch",
          "published_at": "2022-07-27T03:47:09Z"
        },
        {
          "tag": "6.1.0",
          "kind": "minor",
          "published_at": "2022-06-29T05:36:09Z"
        },
        {
          "tag": "6.0.3",
          "kind": "patch",
          "published_at": "2022-05-25T04:10:33Z"
        },
        {
          "tag": "6.0.2",
          "kind": "patch",
          "published_at": "2022-04-27T03:41:08Z"
        },
        {
          "tag": "6.0.1",
          "kind": "patch",
          "published_at": "2022-03-23T02:04:52Z"
        },
        {
          "tag": "6.0.0",
          "kind": "major",
          "published_at": "2022-03-03T04:28:36Z"
        },
        {
          "tag": "5.10.9",
          "kind": "patch",
          "published_at": "2023-11-15T00:42:08Z"
        },
        {
          "tag": "5.10.8",
          "kind": "patch",
          "published_at": "2023-10-19T03:02:47Z"
        },
        {
          "tag": "5.10.7",
          "kind": "patch",
          "published_at": "2022-12-07T03:50:54Z"
        },
        {
          "tag": "5.10.6",
          "kind": "patch",
          "published_at": "2022-10-19T02:16:29Z"
        },
        {
          "tag": "5.10.5",
          "kind": "patch",
          "published_at": "2022-05-25T04:08:16Z"
        },
        {
          "tag": "5.10.4",
          "kind": "patch",
          "published_at": "2022-04-27T03:39:26Z"
        },
        {
          "tag": "5.10.3",
          "kind": "patch",
          "published_at": "2022-02-09T03:24:06Z"
        },
        {
          "tag": "5.10.2",
          "kind": "patch",
          "published_at": "2021-11-17T04:34:27Z"
        },
        {
          "tag": "5.10.1",
          "kind": "patch",
          "published_at": "2021-11-03T03:57:12Z"
        },
        {
          "tag": "5.10.0",
          "kind": "minor",
          "published_at": "2021-10-11T03:18:15Z"
        },
        {
          "tag": "5.9.2",
          "kind": "patch",
          "published_at": "2021-09-08T03:45:09Z"
        },
        {
          "tag": "5.9.1",
          "kind": "patch",
          "published_at": "2021-08-27T04:39:18Z"
        },
        {
          "tag": "5.9.0",
          "kind": "minor",
          "published_at": "2021-08-26T05:43:13Z"
        },
        {
          "tag": "5.8.2",
          "kind": "patch",
          "published_at": "2021-06-23T06:52:46Z"
        },
        {
          "tag": "5.8.1",
          "kind": "patch",
          "published_at": "2021-05-20T02:06:43Z"
        },
        {
          "tag": "5.8.0",
          "kind": "minor",
          "published_at": "2021-05-06T02:48:11Z"
        },
        {
          "tag": "5.7.1",
          "kind": "patch",
          "published_at": "2021-03-17T01:43:23Z"
        },
        {
          "tag": "5.7.0",
          "kind": "minor",
          "published_at": "2021-02-10T03:44:04Z"
        },
        {
          "tag": "5.6.2",
          "kind": "patch",
          "published_at": "2020-12-08T07:23:49Z"
        },
        {
          "tag": "5.6.1",
          "kind": "patch",
          "published_at": "2020-11-25T03:13:16Z"
        },
        {
          "tag": "5.6.0",
          "kind": "minor",
          "published_at": "2020-11-18T05:34:55Z"
        },
        {
          "tag": "5.5.1",
          "kind": "patch",
          "published_at": "2020-10-01T05:31:22Z"
        },
        {
          "tag": "5.5.0",
          "kind": "minor",
          "published_at": "2020-09-29T04:32:21Z"
        },
        {
          "tag": "5.4.2",
          "kind": "patch",
          "published_at": "2020-08-17T04:00:30Z"
        },
        {
          "tag": "5.4.1",
          "kind": "patch",
          "published_at": "2020-07-08T04:08:07Z"
        },
        {
          "tag": "5.4.0",
          "kind": "minor",
          "published_at": "2020-06-30T05:22:55Z"
        },
        {
          "tag": "5.3.2",
          "kind": "patch",
          "published_at": "2020-06-10T04:52:49Z"
        },
        {
          "tag": "5.3.1",
          "kind": "patch",
          "published_at": "2020-05-27T04:42:29Z"
        },
        {
          "tag": "4.9.11",
          "kind": "patch",
          "published_at": "2020-07-13T05:29:19Z"
        },
        {
          "tag": "4.5.12",
          "kind": "patch",
          "published_at": "2020-07-14T01:53:37Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "23137d1b2f95cdd68f304292685157ba090e7518",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-07-15T02:36:42Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "147b97ffe8a7ccb8ea004aa0999d420d6bc27a6f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-07-01T03:39:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4ec295845c55ee20abd551c98bc42f1079c43c83",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-06-03T03:28:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "265989e814097c17f3196d33244a778c4925e80b",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-05-19T23:39:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4e5c520b2b6d52a6251316ab2e4af383c5e753bd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-05-19T23:38:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fcfc14e367d0aa6c72d018278776ef22dc2e8a8f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-04-29T05:18:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "268583cbd56a9ed30d38856deab8cfd48727b746",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-03-31T06:07:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f05e38fecf76287442dd3301786955a83bbe954f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-02-11T03:44:54Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b043a865f1978056f6649638b2e983c0624ff66",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-01-14T01:01:47Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d611e7b064eab7808a0d8d581776c5884a5b687a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-12-17T00:53:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f7f49401cf141bbb9abaff53067db88959969a70",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-12-10T01:56:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8d7491f2ee341c201b68cc7c3701d54703edd474",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-11-17T03:22:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18afc89787771029c09238e08ef5c6f6b64169b5",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-11-06T00:55:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7dcce3851a3c9bec77b73a303c62784a98758d3d",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-10-23T01:11:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d93b748fa069acc845901677a97fb701b0eec7ba",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-18T08:46:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18b9387d799663ebb9a4631e87bbd8727f4a8656",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-17T15:22:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "905d51da18b6eae3b233addec8058d6a78575045",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-17T04:18:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1d90c814d8821567291bc1de2eb84f4da8d6abd4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-08-14T02:39:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "da439f1d4bbfaab97fb59102ad29b325b8313c70",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-07-28T04:53:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1b7f5ef6e6e11318ce3749fb60ef517cc3c2adcc",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-07-23T02:30:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3d6219296c9a92c87337bb38fb502a469ac1167f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-05-29T02:22:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "41ca209b741864a96b11ca34294b2eeba873ff01",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-05-15T01:47:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "88d1b2874256895338034dba28bf6e920aa4ba17",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-04-09T02:06:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "841a2f73ed89df874d5abca7286c344353098f14",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-03-19T03:36:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c92b29a72c467c07799fd09dc9e0add45cf504a1",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-03-05T00:36:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b04481b24137029525f6dc372706fa9d3168f14",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-02-20T08:31:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f0b12677418f3cbb2aeffc2216bd36b0590dd418",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-01-22T03:57:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0c4bc43d572ea9673468bf12cc30e8fb556550f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-12-11T04:56:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3ba28fd6a4037849dbdaf7f6341493b23db9e13c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-11-13T03:16:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ca7a694db4fff387bb6ca9775ddd3d3b5eba3d9c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-11-06T03:04:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e4d46be06c8d0d99f542e7199d1283850fb9192c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-10-10T05:50:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d48b4828c5f66dfb5171a71c47671e0d556dc2b4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-10-09T05:28:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e92ab7adaa3db1752639361ded41a7abb2d28996",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-08-07T06:30:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "db05d34dd0964dd241045cfc319c3a1bd45773e8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-07-03T05:25:26Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ca4b8ce34f4d4f4c1485da90a4247886c4e45335",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-06-19T06:08:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c587e0ce032898f6528ffc8374f1ebe3011b9158",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-06-05T05:16:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f671e05aca24ac73298ae4922b34607b634d59f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-05-22T08:18:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "05a2ae86f455231d1734f2442664b6891ec4d8dd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-05-08T05:24:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "863759766e2397d1f639c63d006680a9e8ba6233",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-04-10T07:29:34Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c011b5164178ac5224e658bf2aed713479fc78ae",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-03-20T05:46:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "01d1959b1200e0b872ea078e59ea5abfb5c54100",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-02-08T23:33:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b0073db409746748af4fc06fbee337bb99f462d9",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-12-11T03:21:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "15c7e5ccd1398486b773f2fc48dafc2d2ffaee8f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-29T09:44:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "56a705dcfe30211053cae2e21e5c7dc65fa7b083",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-22T11:14:25Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2a1344eb95eb8ed512f4ad56986bfc230c8c74c7",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-15T00:41:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a4c139bde17a4e8b2e84d225020cd5acc24a728a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-10-25T06:42:18Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b1ddb5ec9b0c7f5d542429a044bd303648d2d647",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-10-19T03:04:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "02e194ec4d37aab8335332f8ac3e8d2292ba2d47",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-30T11:10:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b795ce4049e2038c79d0ec940de78f17cbe4694",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-09T04:58:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6d4ca510724901084dde245481129b1cbea3aa74",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-02T05:17:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "575e3a4a602619a3d9e1cd0d437ce875ff756395",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-07-12T06:32:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3212d377b2132acc89c4887941e946fb61b33ee6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-06-19T04:36:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "31251ab0bdc693efb4d510a2d0edb07d47ca355c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-06-13T00:10:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6a37da4822eebcd2706793454b07bd891c5277a8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-04-26T10:48:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b2327c03fba64f8c47ec030c1f3bce98da8f7596",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-03-29T01:33:40Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "488a05ddf56e844e593a3fb7da68aa5fb41f01ac",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-03-16T00:43:05Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6880668bef341a0572a8354768bb1f7f53f7121c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-02-22T07:52:19Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bec6271ca90b2f37db48a955697746c1f58b9358",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-12-06T02:19:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "058c00937b0128720e3663d0bfcfe49d2926cf92",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-11-23T02:47:17Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "396dc0d4c4a970918e5a4322c7957c90c85c4c4f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-09-08T04:15:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e6c8b0aa624deb507094918b5dd689d9fea28070",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-07-29T00:24:40Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34ec83b058c32a19b62a15212995122c1ef79cdd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-07-27T03:47:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c6cbe460317484cb45daec0dbabfe4c1d0bf6cc8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-06-29T05:36:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9563ee68e845cc256cc371a6c76a750a4bab7c15",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-05-25T04:10:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6eb0c53e09bd552740dee0ede369f6b97d6983d5",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-04-27T03:41:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8898185c29290f52515bbd1ce53816181ce37c0f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-03-23T02:04:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "44ce3f31e18e9c70ec8210fe960fdb4941cd59f3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-03-03T04:28:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dadd7f25e31680f1c6bf61d2fb0b15794f425cd1",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-02-09T03:24:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ef9962f1d40abbb80a4fd4f023151fd28f891a6c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-11-17T04:34:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "23dbb5d218707805b74c9fe4f1e2525bcd21e689",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-11-03T03:57:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dbd8fefb0bbe96ed15f9af4518b078ae2c20e020",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-10-11T03:18:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "48c665ad12ba0e4d8068ba0784026c7488aa4746",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-09-08T03:45:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2692079b210682c63f12418ff613555efec218fd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-08-27T04:39:18Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a479e525582d09f315c2cf2a99075d6a798b535",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-08-26T05:43:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dbf8c9ab481e11b660a957257c73f55e2af83b20",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-06-23T06:52:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7bbf6f5f7cfa927286523a7681fd20b8489f0709",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-05-20T02:06:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d2358148183b3887b9d7285b6207a8345da2adc6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-05-06T02:48:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8273fb332de43e7929b7b78c13c72b32871f7394",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-03-17T01:43:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "729e1f713c3b6d526daa6cb8f7a3b3ad864c53e3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-02-10T03:44:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "310051defb85fec8581ace8b739ab7b18023db8a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-12-08T07:23:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f78490be294c347958f310e547582856b8aa8101",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-11-25T03:13:16Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "933ded7b599708ed26b7524add7bbce21e777805",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-11-18T05:34:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a436d254bc8d62e50be1fdb3d3e98981ab0e4c40",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-10-01T05:31:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a2c91ba89b76a3cf1df632ab7f84a608f5ba52a0",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-09-29T04:32:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "71197b6a12405d7a6e2067f725c387595bd9b3f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-08-17T04:00:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "940fdcfa7aa2ade09a1ec916dadeee01baa7787a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-07-08T04:08:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "aa17e50a1302fdb601a56e99b7b59f7abe5ff2a6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-06-30T05:22:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d61fb3a8f356c3e333e0108ac539c32aeadadfb3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-06-10T04:52:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "680aa992f10f6ca37a700d5cfacf18beac86911b",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-05-27T04:42:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5831401fd1681524b32992f6c485ef180ea84d2f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-05-21T03:33:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a9e4928aac63b18db3bc670661f8661133c3c205",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-04-23T02:47:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "29bd1c22d35ad8a27982fddbe11a84a124c24b40",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-03-25T02:45:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3653eec90aba773ebd66183fb867c77af21b2c7c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-02-13T04:02:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1a55d7d048c62c64c3f43734dfaa4bc0d776a035",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.6 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-01-28T05:08:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "26d9f929904015cc5c269418e0b86c522a8f8846",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.5 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-19T06:21:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7fcdd149d2e2f6013c78a965b8fab2bbe011de4f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.4 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-11T03:56:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9332192a57fae1d717780486eabfd2d661e3b7e8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-04T03:23:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7587e9a7d09ea0a2ae16f6628918c1bd18df2baa",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-11-19T04:29:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "782aa3876f354b8d04fbf1124c4aa440cec9d199",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-10-28T06:39:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a4eca7a227e4dd97ed4356f708f0f481ab5164cb",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-10-17T06:09:31Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 100,
      "commits_last_year": 20,
      "latest_release_at": "2026-07-15T02:36:42Z",
      "latest_release_tag": "8.8.0",
      "releases_from_tags": true,
      "days_since_last_push": 6,
      "active_weeks_last_year": 16,
      "days_since_latest_release": 6,
      "mean_days_between_releases": 26.7
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "tinymce",
          "exists": true,
          "license": "SEE LICENSE IN license.md",
          "keywords": [
            "wysiwyg",
            "tinymce",
            "richtext",
            "javascript",
            "html",
            "text",
            "rich editor",
            "rich text editor",
            "rte",
            "rich text",
            "contenteditable",
            "editing"
          ],
          "ecosystem": "npm",
          "matches_repo": false,
          "registry_url": "https://www.npmjs.com/package/tinymce",
          "is_deprecated": false,
          "latest_version": "8.8.0",
          "repository_url": "https://github.com/tinymce/tinymce",
          "versions_count": 218,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 3,
          "monthly_downloads": 4489241,
          "first_published_at": "2014-05-06T10:59:32.298000Z",
          "latest_published_at": "2026-07-15T02:38:50.723000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 6
        },
        {
          "name": "tinymce/tinymce",
          "exists": true,
          "license": "SEE LICENSE IN license.md",
          "keywords": [
            "text",
            "javascript",
            "wysiwyg",
            "tinymce",
            "html",
            "editing",
            "richtext",
            "contenteditable",
            "rte",
            "rich editor",
            "rich text editor",
            "rich text"
          ],
          "ecosystem": "packagist",
          "matches_repo": true,
          "registry_url": "https://packagist.org/packages/tinymce/tinymce",
          "is_deprecated": false,
          "latest_version": "8.8.0",
          "repository_url": "https://github.com/tinymce/tinymce-dist",
          "versions_count": 243,
          "total_downloads": 8167016,
          "dependents_count": 115,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": 173352,
          "first_published_at": null,
          "latest_published_at": "2026-07-15T02:36:42Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 6
        }
      ]
    },
    "popularity": {
      "forks": 158,
      "stars": 170,
      "watchers": 24,
      "fork_history": {
        "days": [
          {
            "date": "2014-09-16",
            "count": 1
          },
          {
            "date": "2014-11-03",
            "count": 1
          },
          {
            "date": "2014-11-20",
            "count": 1
          },
          {
            "date": "2014-11-25",
            "count": 1
          },
          {
            "date": "2015-02-05",
            "count": 1
          },
          {
            "date": "2015-03-15",
            "count": 1
          },
          {
            "date": "2015-03-27",
            "count": 1
          },
          {
            "date": "2015-04-24",
            "count": 1
          },
          {
            "date": "2015-04-27",
            "count": 1
          },
          {
            "date": "2015-05-02",
            "count": 1
          },
          {
            "date": "2015-05-19",
            "count": 1
          },
          {
            "date": "2015-06-06",
            "count": 1
          },
          {
            "date": "2015-06-09",
            "count": 1
          },
          {
            "date": "2015-06-25",
            "count": 1
          },
          {
            "date": "2015-07-27",
            "count": 1
          },
          {
            "date": "2015-07-28",
            "count": 1
          },
          {
            "date": "2015-08-17",
            "count": 1
          },
          {
            "date": "2015-08-24",
            "count": 1
          },
          {
            "date": "2015-09-11",
            "count": 1
          },
          {
            "date": "2015-10-02",
            "count": 1
          },
          {
            "date": "2015-10-09",
            "count": 1
          },
          {
            "date": "2015-10-15",
            "count": 1
          },
          {
            "date": "2015-11-19",
            "count": 1
          },
          {
            "date": "2015-12-18",
            "count": 1
          },
          {
            "date": "2016-02-22",
            "count": 1
          },
          {
            "date": "2016-03-23",
            "count": 1
          },
          {
            "date": "2016-03-25",
            "count": 1
          },
          {
            "date": "2016-03-30",
            "count": 1
          },
          {
            "date": "2016-04-06",
            "count": 1
          },
          {
            "date": "2016-04-15",
            "count": 1
          },
          {
            "date": "2016-04-19",
            "count": 1
          },
          {
            "date": "2016-05-27",
            "count": 1
          },
          {
            "date": "2016-06-10",
            "count": 1
          },
          {
            "date": "2016-07-05",
            "count": 1
          },
          {
            "date": "2016-07-07",
            "count": 1
          },
          {
            "date": "2016-07-11",
            "count": 2
          },
          {
            "date": "2016-08-02",
            "count": 1
          },
          {
            "date": "2016-10-22",
            "count": 1
          },
          {
            "date": "2016-12-19",
            "count": 1
          },
          {
            "date": "2017-02-27",
            "count": 1
          },
          {
            "date": "2017-07-12",
            "count": 1
          },
          {
            "date": "2017-10-03",
            "count": 1
          },
          {
            "date": "2017-10-05",
            "count": 1
          },
          {
            "date": "2017-10-07",
            "count": 1
          },
          {
            "date": "2017-10-10",
            "count": 1
          },
          {
            "date": "2017-11-29",
            "count": 1
          },
          {
            "date": "2017-12-07",
            "count": 1
          },
          {
            "date": "2017-12-21",
            "count": 1
          },
          {
            "date": "2018-01-30",
            "count": 1
          },
          {
            "date": "2018-03-07",
            "count": 1
          },
          {
            "date": "2018-03-29",
            "count": 1
          },
          {
            "date": "2018-04-03",
            "count": 1
          },
          {
            "date": "2018-04-09",
            "count": 1
          },
          {
            "date": "2018-04-16",
            "count": 1
          },
          {
            "date": "2018-07-11",
            "count": 1
          },
          {
            "date": "2018-07-16",
            "count": 1
          },
          {
            "date": "2018-08-06",
            "count": 1
          },
          {
            "date": "2018-08-20",
            "count": 1
          },
          {
            "date": "2018-08-23",
            "count": 2
          },
          {
            "date": "2018-09-19",
            "count": 1
          },
          {
            "date": "2018-09-21",
            "count": 1
          },
          {
            "date": "2018-10-04",
            "count": 1
          },
          {
            "date": "2018-10-30",
            "count": 1
          },
          {
            "date": "2018-11-21",
            "count": 1
          },
          {
            "date": "2018-11-28",
            "count": 1
          },
          {
            "date": "2018-12-11",
            "count": 1
          },
          {
            "date": "2018-12-19",
            "count": 1
          },
          {
            "date": "2019-01-09",
            "count": 2
          },
          {
            "date": "2019-01-25",
            "count": 1
          },
          {
            "date": "2019-02-05",
            "count": 1
          },
          {
            "date": "2019-02-10",
            "count": 1
          },
          {
            "date": "2019-02-11",
            "count": 1
          },
          {
            "date": "2019-03-15",
            "count": 1
          },
          {
            "date": "2019-03-30",
            "count": 1
          },
          {
            "date": "2019-04-04",
            "count": 1
          },
          {
            "date": "2019-04-09",
            "count": 1
          },
          {
            "date": "2019-04-29",
            "count": 1
          },
          {
            "date": "2019-05-09",
            "count": 1
          },
          {
            "date": "2019-06-14",
            "count": 1
          },
          {
            "date": "2019-07-12",
            "count": 1
          },
          {
            "date": "2019-08-31",
            "count": 1
          },
          {
            "date": "2019-10-09",
            "count": 1
          },
          {
            "date": "2019-10-11",
            "count": 1
          },
          {
            "date": "2019-11-07",
            "count": 1
          },
          {
            "date": "2019-11-18",
            "count": 1
          },
          {
            "date": "2019-12-28",
            "count": 1
          },
          {
            "date": "2020-01-24",
            "count": 2
          },
          {
            "date": "2020-02-07",
            "count": 1
          },
          {
            "date": "2020-04-02",
            "count": 1
          },
          {
            "date": "2020-04-10",
            "count": 1
          },
          {
            "date": "2020-04-15",
            "count": 1
          },
          {
            "date": "2020-05-04",
            "count": 1
          },
          {
            "date": "2020-05-15",
            "count": 1
          },
          {
            "date": "2020-05-19",
            "count": 1
          },
          {
            "date": "2020-06-01",
            "count": 1
          },
          {
            "date": "2020-06-12",
            "count": 1
          },
          {
            "date": "2020-06-21",
            "count": 1
          },
          {
            "date": "2020-07-01",
            "count": 1
          },
          {
            "date": "2020-07-09",
            "count": 1
          },
          {
            "date": "2020-07-27",
            "count": 1
          },
          {
            "date": "2020-10-14",
            "count": 1
          },
          {
            "date": "2020-11-09",
            "count": 1
          },
          {
            "date": "2020-12-11",
            "count": 1
          },
          {
            "date": "2020-12-14",
            "count": 1
          },
          {
            "date": "2021-01-18",
            "count": 1
          },
          {
            "date": "2021-01-31",
            "count": 1
          },
          {
            "date": "2021-02-06",
            "count": 1
          },
          {
            "date": "2021-02-20",
            "count": 1
          },
          {
            "date": "2021-03-03",
            "count": 1
          },
          {
            "date": "2021-03-19",
            "count": 1
          },
          {
            "date": "2021-04-08",
            "count": 1
          },
          {
            "date": "2021-05-14",
            "count": 1
          },
          {
            "date": "2021-05-21",
            "count": 1
          },
          {
            "date": "2021-06-03",
            "count": 1
          },
          {
            "date": "2021-06-15",
            "count": 1
          },
          {
            "date": "2021-06-29",
            "count": 1
          },
          {
            "date": "2021-09-01",
            "count": 1
          },
          {
            "date": "2021-09-27",
            "count": 1
          },
          {
            "date": "2021-10-06",
            "count": 1
          },
          {
            "date": "2021-11-21",
            "count": 1
          },
          {
            "date": "2021-11-23",
            "count": 1
          },
          {
            "date": "2021-11-25",
            "count": 1
          },
          {
            "date": "2022-01-11",
            "count": 1
          },
          {
            "date": "2022-01-23",
            "count": 1
          },
          {
            "date": "2022-02-16",
            "count": 1
          },
          {
            "date": "2022-03-22",
            "count": 1
          },
          {
            "date": "2022-04-19",
            "count": 1
          },
          {
            "date": "2022-06-14",
            "count": 1
          },
          {
            "date": "2022-07-12",
            "count": 1
          },
          {
            "date": "2022-07-26",
            "count": 1
          },
          {
            "date": "2022-08-01",
            "count": 1
          },
          {
            "date": "2022-08-08",
            "count": 1
          },
          {
            "date": "2022-08-17",
            "count": 1
          },
          {
            "date": "2022-08-22",
            "count": 2
          },
          {
            "date": "2022-09-02",
            "count": 1
          },
          {
            "date": "2022-09-09",
            "count": 1
          },
          {
            "date": "2022-11-09",
            "count": 1
          },
          {
            "date": "2023-02-22",
            "count": 1
          },
          {
            "date": "2023-03-10",
            "count": 1
          },
          {
            "date": "2023-03-26",
            "count": 1
          },
          {
            "date": "2023-04-28",
            "count": 1
          },
          {
            "date": "2024-08-06",
            "count": 1
          },
          {
            "date": "2025-05-29",
            "count": 1
          },
          {
            "date": "2025-08-28",
            "count": 1
          },
          {
            "date": "2025-08-29",
            "count": 1
          },
          {
            "date": "2025-09-19",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 151,
        "total_forks": 158
      },
      "star_history": {
        "days": [
          {
            "date": "2014-05-08",
            "count": 1
          },
          {
            "date": "2014-05-15",
            "count": 1
          },
          {
            "date": "2014-05-16",
            "count": 1
          },
          {
            "date": "2014-05-19",
            "count": 1
          },
          {
            "date": "2014-05-31",
            "count": 1
          },
          {
            "date": "2014-06-25",
            "count": 1
          },
          {
            "date": "2014-07-23",
            "count": 1
          },
          {
            "date": "2014-08-15",
            "count": 1
          },
          {
            "date": "2014-08-18",
            "count": 1
          },
          {
            "date": "2014-10-20",
            "count": 1
          },
          {
            "date": "2014-10-27",
            "count": 1
          },
          {
            "date": "2014-11-04",
            "count": 1
          },
          {
            "date": "2014-11-21",
            "count": 1
          },
          {
            "date": "2014-12-29",
            "count": 1
          },
          {
            "date": "2015-01-20",
            "count": 1
          },
          {
            "date": "2015-02-19",
            "count": 1
          },
          {
            "date": "2015-03-17",
            "count": 1
          },
          {
            "date": "2015-06-10",
            "count": 1
          },
          {
            "date": "2015-06-29",
            "count": 1
          },
          {
            "date": "2015-07-08",
            "count": 1
          },
          {
            "date": "2015-07-28",
            "count": 1
          },
          {
            "date": "2015-08-07",
            "count": 1
          },
          {
            "date": "2015-12-01",
            "count": 1
          },
          {
            "date": "2015-12-11",
            "count": 2
          },
          {
            "date": "2016-01-04",
            "count": 1
          },
          {
            "date": "2016-01-07",
            "count": 1
          },
          {
            "date": "2016-01-13",
            "count": 1
          },
          {
            "date": "2016-02-24",
            "count": 1
          },
          {
            "date": "2016-04-21",
            "count": 2
          },
          {
            "date": "2016-05-18",
            "count": 1
          },
          {
            "date": "2016-09-05",
            "count": 1
          },
          {
            "date": "2016-10-25",
            "count": 1
          },
          {
            "date": "2017-01-10",
            "count": 1
          },
          {
            "date": "2017-01-11",
            "count": 1
          },
          {
            "date": "2017-02-14",
            "count": 1
          },
          {
            "date": "2017-02-21",
            "count": 1
          },
          {
            "date": "2017-03-05",
            "count": 1
          },
          {
            "date": "2017-03-30",
            "count": 1
          },
          {
            "date": "2017-05-09",
            "count": 1
          },
          {
            "date": "2017-06-25",
            "count": 1
          },
          {
            "date": "2017-09-10",
            "count": 1
          },
          {
            "date": "2017-12-21",
            "count": 1
          },
          {
            "date": "2017-12-27",
            "count": 1
          },
          {
            "date": "2018-01-03",
            "count": 1
          },
          {
            "date": "2018-01-14",
            "count": 1
          },
          {
            "date": "2018-02-20",
            "count": 1
          },
          {
            "date": "2018-03-20",
            "count": 1
          },
          {
            "date": "2018-03-26",
            "count": 1
          },
          {
            "date": "2018-04-11",
            "count": 1
          },
          {
            "date": "2018-05-17",
            "count": 1
          },
          {
            "date": "2018-06-08",
            "count": 2
          },
          {
            "date": "2018-06-15",
            "count": 1
          },
          {
            "date": "2018-06-29",
            "count": 1
          },
          {
            "date": "2018-07-31",
            "count": 2
          },
          {
            "date": "2018-08-12",
            "count": 1
          },
          {
            "date": "2018-09-01",
            "count": 1
          },
          {
            "date": "2018-09-07",
            "count": 1
          },
          {
            "date": "2018-09-27",
            "count": 1
          },
          {
            "date": "2018-11-03",
            "count": 1
          },
          {
            "date": "2019-01-09",
            "count": 1
          },
          {
            "date": "2019-02-18",
            "count": 1
          },
          {
            "date": "2019-02-28",
            "count": 1
          },
          {
            "date": "2019-03-08",
            "count": 1
          },
          {
            "date": "2019-03-15",
            "count": 1
          },
          {
            "date": "2019-04-07",
            "count": 1
          },
          {
            "date": "2019-04-14",
            "count": 1
          },
          {
            "date": "2019-04-18",
            "count": 1
          },
          {
            "date": "2019-05-30",
            "count": 1
          },
          {
            "date": "2019-05-31",
            "count": 1
          },
          {
            "date": "2019-06-12",
            "count": 1
          },
          {
            "date": "2019-06-14",
            "count": 1
          },
          {
            "date": "2019-08-01",
            "count": 1
          },
          {
            "date": "2019-08-29",
            "count": 1
          },
          {
            "date": "2019-09-04",
            "count": 1
          },
          {
            "date": "2019-09-17",
            "count": 1
          },
          {
            "date": "2019-10-11",
            "count": 1
          },
          {
            "date": "2019-10-15",
            "count": 1
          },
          {
            "date": "2019-11-01",
            "count": 1
          },
          {
            "date": "2019-11-02",
            "count": 1
          },
          {
            "date": "2019-12-09",
            "count": 1
          },
          {
            "date": "2020-01-04",
            "count": 1
          },
          {
            "date": "2020-01-17",
            "count": 1
          },
          {
            "date": "2020-01-19",
            "count": 1
          },
          {
            "date": "2020-01-23",
            "count": 1
          },
          {
            "date": "2020-01-24",
            "count": 1
          },
          {
            "date": "2020-03-16",
            "count": 1
          },
          {
            "date": "2020-04-01",
            "count": 2
          },
          {
            "date": "2020-04-02",
            "count": 1
          },
          {
            "date": "2020-04-23",
            "count": 1
          },
          {
            "date": "2020-05-14",
            "count": 1
          },
          {
            "date": "2020-05-22",
            "count": 2
          },
          {
            "date": "2020-06-16",
            "count": 1
          },
          {
            "date": "2020-07-26",
            "count": 1
          },
          {
            "date": "2020-09-22",
            "count": 1
          },
          {
            "date": "2020-10-05",
            "count": 1
          },
          {
            "date": "2020-11-09",
            "count": 1
          },
          {
            "date": "2020-11-21",
            "count": 1
          },
          {
            "date": "2020-12-23",
            "count": 1
          },
          {
            "date": "2021-01-11",
            "count": 1
          },
          {
            "date": "2021-01-31",
            "count": 1
          },
          {
            "date": "2021-02-02",
            "count": 1
          },
          {
            "date": "2021-02-05",
            "count": 1
          },
          {
            "date": "2021-03-06",
            "count": 1
          },
          {
            "date": "2021-03-17",
            "count": 1
          },
          {
            "date": "2021-04-08",
            "count": 1
          },
          {
            "date": "2021-04-21",
            "count": 1
          },
          {
            "date": "2021-04-22",
            "count": 1
          },
          {
            "date": "2021-05-06",
            "count": 1
          },
          {
            "date": "2021-07-12",
            "count": 1
          },
          {
            "date": "2021-07-13",
            "count": 1
          },
          {
            "date": "2021-07-14",
            "count": 1
          },
          {
            "date": "2021-07-17",
            "count": 1
          },
          {
            "date": "2021-07-21",
            "count": 1
          },
          {
            "date": "2021-07-27",
            "count": 1
          },
          {
            "date": "2021-08-16",
            "count": 1
          },
          {
            "date": "2021-08-17",
            "count": 1
          },
          {
            "date": "2021-09-24",
            "count": 1
          },
          {
            "date": "2021-10-05",
            "count": 1
          },
          {
            "date": "2021-11-21",
            "count": 1
          },
          {
            "date": "2021-11-23",
            "count": 1
          },
          {
            "date": "2021-12-13",
            "count": 1
          },
          {
            "date": "2022-01-29",
            "count": 1
          },
          {
            "date": "2022-03-03",
            "count": 1
          },
          {
            "date": "2022-03-20",
            "count": 1
          },
          {
            "date": "2022-04-21",
            "count": 1
          },
          {
            "date": "2022-05-28",
            "count": 1
          },
          {
            "date": "2022-06-07",
            "count": 1
          },
          {
            "date": "2022-07-01",
            "count": 1
          },
          {
            "date": "2022-07-04",
            "count": 1
          },
          {
            "date": "2022-09-01",
            "count": 1
          },
          {
            "date": "2022-09-28",
            "count": 1
          },
          {
            "date": "2022-12-04",
            "count": 1
          },
          {
            "date": "2023-02-22",
            "count": 1
          },
          {
            "date": "2023-02-25",
            "count": 1
          },
          {
            "date": "2023-04-21",
            "count": 1
          },
          {
            "date": "2023-05-02",
            "count": 1
          },
          {
            "date": "2023-05-27",
            "count": 1
          },
          {
            "date": "2023-05-31",
            "count": 1
          },
          {
            "date": "2023-06-26",
            "count": 1
          },
          {
            "date": "2023-08-13",
            "count": 1
          },
          {
            "date": "2023-09-08",
            "count": 1
          },
          {
            "date": "2023-10-16",
            "count": 1
          },
          {
            "date": "2023-10-23",
            "count": 1
          },
          {
            "date": "2023-12-09",
            "count": 1
          },
          {
            "date": "2024-02-25",
            "count": 1
          },
          {
            "date": "2024-03-25",
            "count": 1
          },
          {
            "date": "2024-04-11",
            "count": 1
          },
          {
            "date": "2024-07-07",
            "count": 1
          },
          {
            "date": "2024-10-25",
            "count": 1
          },
          {
            "date": "2024-10-29",
            "count": 1
          },
          {
            "date": "2024-12-27",
            "count": 1
          },
          {
            "date": "2025-02-24",
            "count": 1
          },
          {
            "date": "2025-02-28",
            "count": 1
          },
          {
            "date": "2025-06-09",
            "count": 1
          },
          {
            "date": "2025-07-03",
            "count": 1
          },
          {
            "date": "2025-08-29",
            "count": 1
          },
          {
            "date": "2025-10-20",
            "count": 1
          },
          {
            "date": "2025-12-17",
            "count": 1
          },
          {
            "date": "2026-01-12",
            "count": 1
          },
          {
            "date": "2026-01-15",
            "count": 1
          },
          {
            "date": "2026-02-06",
            "count": 1
          },
          {
            "date": "2026-02-21",
            "count": 1
          },
          {
            "date": "2026-06-19",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 169,
        "total_stars": 170
      },
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "toolchain_manifests": [],
      "largest_source_bytes": 1895997,
      "source_files_sampled": 221,
      "oversized_source_files": 22,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "composer.json",
        "package.json"
      ],
      "advisories": {
        "error": "No resolved dependencies to assess",
        "scope": "repository_graph",
        "source": null,
        "findings": [],
        "collected": false,
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm",
        "packagist"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [],
        "collected": true,
        "truncated": false,
        "total_count": 0,
        "direct_count": 0,
        "indirect_count": 0
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 1,
        "merged_prs": 0,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 12
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "spocke",
          "commits": 74,
          "avatar_url": "https://avatars.githubusercontent.com/u/115879?v=4"
        },
        {
          "type": "User",
          "login": "jhaines",
          "commits": 1,
          "avatar_url": "https://avatars.githubusercontent.com/u/2252638?v=4"
        }
      ],
      "contributors_sampled": 2,
      "top_contributor_share": 0.987
    },
    "quality_signals": {
      "has_ci": false,
      "has_tests": false,
      "ci_workflows": [],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/30 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 3 contributing companies or organizations -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": null,
            "reason": "no workflows found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 9,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 5,
            "reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": null,
            "reason": "no dependencies found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": null,
            "reason": "No tokens found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "23137d1b2f95cdd68f304292685157ba090e7518",
        "ran_at": "2026-07-21T20:25:32Z",
        "aggregate_score": 3.5,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/tinymce/tinymce-dist",
    "host": "github.com",
    "name": "tinymce-dist",
    "owner": "tinymce"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 48,
      "inputs": {
        "security": 35,
        "vitality": 74,
        "community": 61,
        "governance": 45,
        "engineering": 21
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 74,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 64,
            "inputs": {
              "commits_last_year": 20,
              "human_commit_share": 1,
              "days_since_last_push": 6,
              "active_weeks_last_year": 16
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 6 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "16/52 weeks with commits",
                "points": 11.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 16
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "20 commits in the last year",
                "points": 11.9,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 20
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 5,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 88,
            "inputs": {
              "releases_count": 100,
              "latest_release_tag": "8.8.0",
              "releases_from_tags": true,
              "days_since_latest_release": 6,
              "mean_days_between_releases": 26.7
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "100 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 100
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 6 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~26.7 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 26.7
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "maintained",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 6,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "last human commit 6 days ago",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_maintained",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 61,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "moderate",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 62,
            "inputs": {
              "forks": 158,
              "stars": 170,
              "watchers": 24,
              "growth_state": "organic",
              "growth_factor_pct": 100
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "170 stars",
                "points": 36.1,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 170
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "158 forks",
                "points": 18.3,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 158
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "24 watchers",
                "points": 7.6,
                "status": "partial",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 24
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "at_risk",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file present, not a recognized license",
                "points": 16.9,
                "status": "partial",
                "details": [
                  {
                    "code": "license_custom",
                    "params": {}
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "good",
            "name": "Ecosystem adoption (downloads)",
            "note": null,
            "notes": [],
            "value": 84,
            "inputs": {
              "packages": [
                "tinymce/tinymce"
              ],
              "dependents": 115,
              "ecosystems": "packagist",
              "total_downloads": 8167016,
              "monthly_downloads": 173352
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "173,352 downloads/month across packagist",
                "points": 69.9,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 173352,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "115 packages depend on it",
                "points": 13.8,
                "status": "partial",
                "details": [
                  {
                    "code": "registry_dependents",
                    "params": {
                      "count": 115
                    }
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 45,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 22,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 2,
              "top_contributor_share": 0.987
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 99% of commits",
                "points": 0.3,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 99
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "2 contributors",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 3 contributing companies or organizations -- score normalized to 10",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 12
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "0/12 decided PRs merged",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 0,
                      "decided": 12
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/30 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "good",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 74,
            "inputs": {
              "followers": 418,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "tinymce",
              "public_repos": 102,
              "account_age_days": 6173
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "418 followers of tinymce",
                "points": 18.9,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 418,
                      "login": "tinymce"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "102 public repos, account ~16 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 102
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 16
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "tinymce/tinymce"
              ],
              "ecosystems": "packagist",
              "any_deprecated": false,
              "min_days_since_publish": 6
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on packagist",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 6 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "243 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 243
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "critical",
        "name": "Engineering Quality",
        "value": 21,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "critical",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_ci": false,
              "has_tests": false,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "tinymce"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "1 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 35,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "dangerous_workflow",
                    "packaging",
                    "pinned_dependencies",
                    "signed_releases",
                    "token_permissions"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 35,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 12,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 6,
              "scorecard_aggregate": 3.5
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/30 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 3 contributing companies or organizations -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no workflows found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.2,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 3.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "No tokens found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 1
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 10,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "0 of 100 human commits state their intent (structured subject or explanatory body)",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 0,
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "critical",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_pinned_dependencies"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_nix": false,
              "has_tests": false,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [],
              "agent_commit_share": 0,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no agent-authored commits among the last 100",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_authored_commits",
                    "params": {
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no automated dependency updates observed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_dependency_automation",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 1895997,
              "source_files_sampled": 221,
              "oversized_source_files": 22
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "22/221 source files over 60KB",
                "points": 49.5,
                "status": "partial",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 221,
                      "oversized": 22
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring",
    "deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-21T20:25:38.248671Z",
  "schema_version": "0.23.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/t/tinymce/tinymce-dist.svg",
  "full_name": "tinymce/tinymce-dist",
  "license_state": "custom",
  "license_spdx": null
}

Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.

Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.23.0 — metodología completa · wiki de métricas.

Cómo se sitúa un resultado dentro del registro general: estadísticas agregadasnpm, Packagist.