Registro públicoEn riesgo
Informe de salud del softwareesquema 0.23.0 · métricas 1.13.0 · 2026-07-21 20:25 UTC
tinymce / tinymce-dist
Official TinyMCE repository for production usage in package managers
tinymce/tinymce-dist tiene un índice de salud de 48 sobre 100, lo que lo sitúa en la banda En riesgo. Su puntuación más alta es Vitality (74/100) y la más baja, AI Readiness (10/100). Se actualizó por última vez hace 6 días. Una sola persona concentra la mayor parte del trabajo reciente.
48
global / 100Índice de salud del software
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
48
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
Perfil de puntuación
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Titularidad
TinyOrganización
418 seguidores102 repositorios públicosdesde ago 2009
Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.
Ecosistemas de paquetes
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| npm | tinymceapunta a otro repositorio; no se puntúa | 8.8.0 | 4.489.241 | 218 | hace 6 días | wysiwygtinymcerichtextjavascripthtmltextrich-editorrich-text-editorrterich-textcontenteditableediting |
| Packagist | tinymce/tinymce | 8.8.0 | 173.352 | 243 | hace 6 días | textjavascriptwysiwygtinymcehtmleditingrichtextcontenteditablerterich-editorrich-text-editorrich-text |
Métricas por categoría
Vitalidad
¿Está vivo el proyecto: se escribe código y se publican versiones?
74
Actividad de desarrollo
64Moderado
Cómo se puntúa
| 36/36 | Recencia de push — último push hace 6 días |
| 11.1/36 | Cadencia de commits — 16/52 semanas con commits |
| 11.9/18 | Volumen de commits — 20 commits en el último año |
| 5/10 | OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
Datos de entrada utilizados
| commits_last_year | 20 |
| human_commit_share | 1 |
| days_since_last_push | 6 |
| active_weeks_last_year | 16 |
Disciplina de publicación
88Excelente
Cómo se puntúa
| 16.2/27 | Publica versiones — 100 etiquetas de versión (sin releases de GitHub) |
| 36/36 | Recencia de las versiones — última versión hace 6 días |
| 27/27 | Cadencia de publicación — una versión cada ~26,7 días |
| 0/10 | OpenSSF Scorecard: Signed-Releases — sin datos |
Datos de entrada utilizados
| releases_count | 100 |
| latest_release_tag | 8.8.0 |
| releases_from_tags | sí |
| days_since_latest_release | 6 |
| mean_days_between_releases | 26,7 |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Signed-Releases. Los pesos restantes se han renormalizado.
Comunidad y Adopción
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
61
Popularidad y adopción
62Moderado
Cómo se puntúa
| 36.1/60 | Estrellas — 170 estrellas |
| 18.3/25 | Forks — 158 forks |
| 7.6/15 | Observadores — 24 observadores |
Datos de entrada utilizados
| forks | 158 |
| stars | 170 |
| watchers | 24 |
| growth_state | organic |
| growth_factor_pct | 100 |
Salud de la comunidad
44En riesgo
Cómo se puntúa
| 22.5/22.5 | README |
| 16.9/22.5 | Licencia — archivo de licencia presente, no es una licencia reconocida |
| 0/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 0/6.3 | Plantilla de PR |
Datos de entrada utilizados
| has_readme | sí |
| has_license | sí |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
Cómo se puntúa
| 69.9/80 | Descargas mensuales — 173.352 descargas/mes en packagist |
| 13.8/20 | Dependientes en el registro — 115 paquetes dependen de él |
Datos de entrada utilizados
| packages | tinymce/tinymce |
| dependents | 115 |
| ecosystems | packagist |
| total_downloads | 8.167.016 |
| monthly_downloads | 173.352 |
Sostenibilidad y Gobernanza
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
45
Cómo se puntúa
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 0.3/22.5 | Distribución de commits — el principal contribuyente firma el 99% de los commits |
| 2.7/13.5 | Amplitud de contribuyentes — 2 contribuyentes |
| 10/10 | OpenSSF Scorecard: Contributors — project has 3 contributing companies or organizations -- score normalized to 10 |
Datos de entrada utilizados
| bus_factor | 1 |
| contributors_sampled | 2 |
| top_contributor_share | 0,987 |
Cómo se puntúa
| 0/46.8 | Resolución de issues — sin issues o sin datos |
| 0/38.3 | Aceptación de PR — 0/12 PR decididos fusionados |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Datos de entrada utilizados
| merged_prs | 0 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 12 |
Excluidos de la puntuación (sin datos o no aplicable): Resolución de issues. Los pesos restantes se han renormalizado.
Propiedad y custodia
74Bueno
Cómo se puntúa
| 30/30 | Respaldo de la propiedad — propiedad de una organización |
| 0/20 | Dominio verificado |
| 18.9/25 | Alcance del propietario — 418 seguidores de tinymce |
| 25/25 | Trayectoria — 102 repos públicos, cuenta de ~16 años |
Datos de entrada utilizados
| followers | 418 |
| owner_type | Organization |
| is_verified | — |
| owner_login | tinymce |
| public_repos | 102 |
| account_age_days | 6173 |
Mantenimiento de paquetes
100Excelente
Cómo se puntúa
| 25/25 | Publicado y resoluble — 1 paquete(s) en packagist |
| 35/35 | Recencia de publicación — última publicación hace 6 días |
| 20/20 | Historial de versiones — 243 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
Datos de entrada utilizados
| packages | tinymce/tinymce |
| ecosystems | packagist |
| any_deprecated | no |
| min_days_since_publish | 6 |
Calidad de Ingeniería
¿Existen unas prácticas mínimas de ingeniería y documentación?
21
Prácticas de ingeniería
1Crítico
Cómo se puntúa
| 0/24 | Flujos de trabajo de CI |
| 0/24 | Pruebas presentes |
| 0/16 | Configuración de linter |
| 0/9.6 | Hooks de pre-commit |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — sin datos |
Datos de entrada utilizados
| has_ci | no |
| has_tests | no |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: CI-Tests. Los pesos restantes se han renormalizado.
Documentación
50Moderado
Cómo se puntúa
| 30/30 | README |
| 0/25 | Directorio de documentación |
| 0/15 | Sitio de documentación / página del proyecto |
| 10/10 | Descripción del repositorio |
| 10/10 | Topics — 1 topics |
| 0/10 | Wiki |
Datos de entrada utilizados
| topics | tinymce |
| has_wiki | no |
| homepage | — |
| has_readme | sí |
| has_docs_dir | no |
| has_description | sí |
Seguridad
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
35
Postura de seguridad
35En riesgo
Cómo se puntúa
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — sin datos |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 2.5/2.5 | Contributors — project has 3 contributing companies or organizations -- score normalized to 10 |
| 0/10 | Dangerous-Workflow — sin datos |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.2/2.5 | Licencia — license file detected |
| 3.8/7.5 | Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| 0/5 | Packaging — sin datos |
| 0/5 | Pinned-Dependencies — sin datos |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — sin datos |
| 0/7.5 | Token-Permissions — sin datos |
| 7.5/7.5 | Vulnerabilities — 0 existing vulnerabilities detected |
Datos de entrada utilizados
| source | openssf_scorecard |
| checks_evaluated | 12 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 6 |
| scorecard_aggregate | 3,5 |
Excluidos de la puntuación (sin datos o no aplicable): ci_tests, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Los pesos restantes se han renormalizado.
Preparación para IA
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
10
Contexto y guía para agentes
1Crítico
Cómo se puntúa
| 0/45 | Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 0/40 | Historial de commits legible — 0 de 100 commits humanos declaran su intención (asunto estructurado o cuerpo explicativo) |
Datos de entrada utilizados
| has_llms_txt | no |
| legible_history_share | 0 |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
Cómo se puntúa
| 0/18 | Arranque con un solo comando |
| 0/22 | Pruebas automatizadas |
| 0/11 | Configuración de lint / formato |
| 0/11 | Verificación estática de tipos |
| 0/10 | Entorno reproducible |
| 0/10 | Práctica demostrada con agentes — ningún commit con autoría de agente entre los últimos 100 |
| 0/8 | Mantenimiento automatizado — no se observan actualizaciones automáticas de dependencias |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — sin datos |
Datos de entrada utilizados
| has_nix | no |
| has_tests | no |
| lockfiles | — |
| has_dockerfile | no |
| typed_language | no |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | — |
| agent_commit_share | 0 |
| toolchain_manifests | — |
| dependency_bot_commit_share | 0 |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: Pinned-Dependencies. Los pesos restantes se han renormalizado.
Legibilidad del código para modelos
50Moderado
Cómo se puntúa
| 0/45 | Código verificable por tipos — JavaScript sin configuración de verificación de tipos |
| 49.5/55 | Tamaños de archivo manejables — 22/221 archivos fuente de más de 60 KB |
Datos de entrada utilizados
| primary_language | JavaScript |
| largest_source_bytes | 1.895.997 |
| source_files_sampled | 221 |
| oversized_source_files | 22 |
Datos clave
170estrellas de GitHub
2contribuidores
20commits en los últimos 12 meses
6días desde el último push
100versiones publicadas
1factor bus
0issues abiertas
npm, Packagistecosistemas de paquetes
Advertencias de recopilación de datos
- npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring
- deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead
Más detalle
Historial de estrellas y forks 170 ★ / 158 ⇿
170Estrellas
158Forks
98Versiones
Cuándo se añadió cada estrella y fork, recopilado de GitHub y agrupado por día. El crecimiento acumulado se sitúa justo encima de las adiciones diarias que lo componen, de modo que ambos se leen en conjunto: la acumulación orgánica sostenida no se parece en nada a un pico abrupto y efímero. Cuando esa diferencia es medible, se informa como autenticidad del crecimiento.
Mayor 3Menor 30Parche 65
Cada punto abarca 12 días.
OpenSSF Scorecard 3.5 / 10
3.5agregado
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/d | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 10 | Contributors | project has 3 contributing companies or organizations -- score normalized to 10 |
| n/d | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 9 | License | license file detected |
| 5 | Maintained | 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5 |
| n/d | Packaging | packaging workflow not detected |
| n/d | Pinned-Dependencies | no dependencies found |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| n/d | Signed-Releases | no releases found |
| n/d | Token-Permissions | No tokens found |
| 10 | Vulnerabilities | 0 existing vulnerabilities detected |
Todas las dependencias 0
Conjunto completo de dependencias resueltas según el grafo de dependencias de GitHub: 0 paquetes directos y 0 indirectos (transitivos). El cierre transitivo es completo cuando el repositorio incluye un lockfile.
| Registro | Paquete | Versión | Relación |
|---|
Avisos de dependencias sin evaluar
El cotejo de avisos no pudo ejecutarse para este informe: No resolved dependencies to assess
Informe JSON sin procesar legible por máquina
{
"data": {
"repo": {
"topics": [
"tinymce"
],
"is_fork": false,
"size_kb": 51419,
"has_wiki": false,
"homepage": null,
"languages": {
"CSS": 1221547,
"JavaScript": 5155732,
"TypeScript": 270304
},
"pushed_at": "2026-07-15T02:36:44Z",
"created_at": "2014-05-06T10:57:12Z",
"owner_type": "Organization",
"updated_at": "2026-07-15T02:36:49Z",
"description": "Official TinyMCE repository for production usage in package managers",
"is_archived": false,
"is_disabled": false,
"license_spdx": null,
"default_branch": "master",
"license_spdx_raw": "NOASSERTION",
"primary_language": "JavaScript",
"significant_languages": [
"JavaScript",
"CSS"
]
},
"owner": {
"blog": "https://www.tiny.cloud/",
"name": "Tiny",
"type": "Organization",
"login": "tinymce",
"company": null,
"location": null,
"followers": 418,
"avatar_url": "https://avatars.githubusercontent.com/u/119815?v=4",
"created_at": "2009-08-26T18:15:21Z",
"is_verified": null,
"public_repos": 102,
"account_age_days": 6173
},
"license": {
"state": "custom",
"spdx_id": null,
"raw_spdx": "NOASSERTION",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "8.8.0",
"kind": "minor",
"published_at": "2026-07-15T02:36:42Z"
},
{
"tag": "8.7.0",
"kind": "minor",
"published_at": "2026-07-01T03:39:33Z"
},
{
"tag": "8.6.0",
"kind": "minor",
"published_at": "2026-06-03T03:28:15Z"
},
{
"tag": "8.5.1",
"kind": "patch",
"published_at": "2026-05-19T23:39:20Z"
},
{
"tag": "8.5.0",
"kind": "minor",
"published_at": "2026-04-29T05:18:45Z"
},
{
"tag": "8.4.0",
"kind": "minor",
"published_at": "2026-03-31T06:07:53Z"
},
{
"tag": "8.3.2",
"kind": "patch",
"published_at": "2026-01-14T01:01:47Z"
},
{
"tag": "8.3.1",
"kind": "patch",
"published_at": "2025-12-17T00:53:22Z"
},
{
"tag": "8.3.0",
"kind": "minor",
"published_at": "2025-12-10T01:56:11Z"
},
{
"tag": "8.2.2",
"kind": "patch",
"published_at": "2025-11-17T03:22:11Z"
},
{
"tag": "8.2.1",
"kind": "patch",
"published_at": "2025-11-06T00:55:35Z"
},
{
"tag": "8.2.0",
"kind": "minor",
"published_at": "2025-10-23T01:11:24Z"
},
{
"tag": "8.1.2",
"kind": "patch",
"published_at": "2025-09-18T08:46:07Z"
},
{
"tag": "8.1.1",
"kind": "patch",
"published_at": "2025-09-17T15:22:02Z"
},
{
"tag": "8.1.0",
"kind": "minor",
"published_at": "2025-09-17T04:18:06Z"
},
{
"tag": "8.0.2",
"kind": "patch",
"published_at": "2025-08-14T02:39:07Z"
},
{
"tag": "8.0.1",
"kind": "patch",
"published_at": "2025-07-28T04:53:13Z"
},
{
"tag": "8.0.0",
"kind": "major",
"published_at": "2025-07-23T02:30:15Z"
},
{
"tag": "7.9.3",
"kind": "patch",
"published_at": "2026-05-19T23:38:56Z"
},
{
"tag": "7.9.2",
"kind": "patch",
"published_at": "2026-02-11T03:44:54Z"
},
{
"tag": "7.9.1",
"kind": "patch",
"published_at": "2025-05-29T02:22:36Z"
},
{
"tag": "7.9.0",
"kind": "minor",
"published_at": "2025-05-15T01:47:37Z"
},
{
"tag": "7.8.0",
"kind": "minor",
"published_at": "2025-04-09T02:06:27Z"
},
{
"tag": "7.7.2",
"kind": "patch",
"published_at": "2025-03-19T03:36:58Z"
},
{
"tag": "7.7.1",
"kind": "patch",
"published_at": "2025-03-05T00:36:32Z"
},
{
"tag": "7.7.0",
"kind": "minor",
"published_at": "2025-02-20T08:31:02Z"
},
{
"tag": "7.6.1",
"kind": "patch",
"published_at": "2025-01-22T03:57:00Z"
},
{
"tag": "7.6.0",
"kind": "minor",
"published_at": "2024-12-11T04:56:37Z"
},
{
"tag": "7.5.1",
"kind": "patch",
"published_at": "2024-11-13T03:16:27Z"
},
{
"tag": "7.5.0",
"kind": "minor",
"published_at": "2024-11-06T03:04:46Z"
},
{
"tag": "7.4.1",
"kind": "patch",
"published_at": "2024-10-10T05:50:45Z"
},
{
"tag": "7.4.0",
"kind": "minor",
"published_at": "2024-10-09T05:28:03Z"
},
{
"tag": "7.3.0",
"kind": "minor",
"published_at": "2024-08-07T06:30:33Z"
},
{
"tag": "7.2.1",
"kind": "patch",
"published_at": "2024-07-03T05:25:26Z"
},
{
"tag": "7.2.0",
"kind": "minor",
"published_at": "2024-06-19T06:08:58Z"
},
{
"tag": "7.1.2",
"kind": "patch",
"published_at": "2024-06-05T05:16:22Z"
},
{
"tag": "7.1.1",
"kind": "patch",
"published_at": "2024-05-22T08:18:50Z"
},
{
"tag": "7.1.0",
"kind": "minor",
"published_at": "2024-05-08T05:24:56Z"
},
{
"tag": "7.0.1",
"kind": "patch",
"published_at": "2024-04-10T07:29:34Z"
},
{
"tag": "7.0.0",
"kind": "major",
"published_at": "2024-03-20T05:46:56Z"
},
{
"tag": "6.8.6",
"kind": "patch",
"published_at": "2025-05-29T02:36:52Z"
},
{
"tag": "6.8.5",
"kind": "patch",
"published_at": "2024-10-10T06:06:02Z"
},
{
"tag": "6.8.4",
"kind": "patch",
"published_at": "2024-06-19T09:28:48Z"
},
{
"tag": "6.8.3",
"kind": "patch",
"published_at": "2024-02-08T23:33:30Z"
},
{
"tag": "6.8.2",
"kind": "patch",
"published_at": "2023-12-11T03:21:56Z"
},
{
"tag": "6.8.1",
"kind": "patch",
"published_at": "2023-11-29T09:44:11Z"
},
{
"tag": "6.8.0",
"kind": "minor",
"published_at": "2023-11-22T11:14:25Z"
},
{
"tag": "6.7.3",
"kind": "patch",
"published_at": "2023-11-15T00:41:51Z"
},
{
"tag": "6.7.2",
"kind": "patch",
"published_at": "2023-10-25T06:42:18Z"
},
{
"tag": "6.7.1",
"kind": "patch",
"published_at": "2023-10-19T03:04:57Z"
},
{
"tag": "6.7.0",
"kind": "minor",
"published_at": "2023-08-30T11:10:35Z"
},
{
"tag": "6.6.2",
"kind": "patch",
"published_at": "2023-08-09T04:58:32Z"
},
{
"tag": "6.6.1",
"kind": "patch",
"published_at": "2023-08-02T05:17:12Z"
},
{
"tag": "6.6.0",
"kind": "minor",
"published_at": "2023-07-12T06:32:00Z"
},
{
"tag": "6.5.1",
"kind": "patch",
"published_at": "2023-06-19T04:36:46Z"
},
{
"tag": "6.5.0",
"kind": "minor",
"published_at": "2023-06-13T00:10:53Z"
},
{
"tag": "6.4.2",
"kind": "patch",
"published_at": "2023-04-26T10:48:15Z"
},
{
"tag": "6.4.1",
"kind": "patch",
"published_at": "2023-03-29T01:33:40Z"
},
{
"tag": "6.4.0",
"kind": "minor",
"published_at": "2023-03-16T00:43:05Z"
},
{
"tag": "6.3.2",
"kind": "patch",
"published_at": "2023-02-22T07:52:19Z"
},
{
"tag": "6.3.1",
"kind": "patch",
"published_at": "2022-12-06T02:19:08Z"
},
{
"tag": "6.3.0",
"kind": "minor",
"published_at": "2022-11-23T02:47:17Z"
},
{
"tag": "6.2.0",
"kind": "minor",
"published_at": "2022-09-08T04:15:30Z"
},
{
"tag": "6.1.2",
"kind": "patch",
"published_at": "2022-07-29T00:24:40Z"
},
{
"tag": "6.1.1",
"kind": "patch",
"published_at": "2022-07-27T03:47:09Z"
},
{
"tag": "6.1.0",
"kind": "minor",
"published_at": "2022-06-29T05:36:09Z"
},
{
"tag": "6.0.3",
"kind": "patch",
"published_at": "2022-05-25T04:10:33Z"
},
{
"tag": "6.0.2",
"kind": "patch",
"published_at": "2022-04-27T03:41:08Z"
},
{
"tag": "6.0.1",
"kind": "patch",
"published_at": "2022-03-23T02:04:52Z"
},
{
"tag": "6.0.0",
"kind": "major",
"published_at": "2022-03-03T04:28:36Z"
},
{
"tag": "5.10.9",
"kind": "patch",
"published_at": "2023-11-15T00:42:08Z"
},
{
"tag": "5.10.8",
"kind": "patch",
"published_at": "2023-10-19T03:02:47Z"
},
{
"tag": "5.10.7",
"kind": "patch",
"published_at": "2022-12-07T03:50:54Z"
},
{
"tag": "5.10.6",
"kind": "patch",
"published_at": "2022-10-19T02:16:29Z"
},
{
"tag": "5.10.5",
"kind": "patch",
"published_at": "2022-05-25T04:08:16Z"
},
{
"tag": "5.10.4",
"kind": "patch",
"published_at": "2022-04-27T03:39:26Z"
},
{
"tag": "5.10.3",
"kind": "patch",
"published_at": "2022-02-09T03:24:06Z"
},
{
"tag": "5.10.2",
"kind": "patch",
"published_at": "2021-11-17T04:34:27Z"
},
{
"tag": "5.10.1",
"kind": "patch",
"published_at": "2021-11-03T03:57:12Z"
},
{
"tag": "5.10.0",
"kind": "minor",
"published_at": "2021-10-11T03:18:15Z"
},
{
"tag": "5.9.2",
"kind": "patch",
"published_at": "2021-09-08T03:45:09Z"
},
{
"tag": "5.9.1",
"kind": "patch",
"published_at": "2021-08-27T04:39:18Z"
},
{
"tag": "5.9.0",
"kind": "minor",
"published_at": "2021-08-26T05:43:13Z"
},
{
"tag": "5.8.2",
"kind": "patch",
"published_at": "2021-06-23T06:52:46Z"
},
{
"tag": "5.8.1",
"kind": "patch",
"published_at": "2021-05-20T02:06:43Z"
},
{
"tag": "5.8.0",
"kind": "minor",
"published_at": "2021-05-06T02:48:11Z"
},
{
"tag": "5.7.1",
"kind": "patch",
"published_at": "2021-03-17T01:43:23Z"
},
{
"tag": "5.7.0",
"kind": "minor",
"published_at": "2021-02-10T03:44:04Z"
},
{
"tag": "5.6.2",
"kind": "patch",
"published_at": "2020-12-08T07:23:49Z"
},
{
"tag": "5.6.1",
"kind": "patch",
"published_at": "2020-11-25T03:13:16Z"
},
{
"tag": "5.6.0",
"kind": "minor",
"published_at": "2020-11-18T05:34:55Z"
},
{
"tag": "5.5.1",
"kind": "patch",
"published_at": "2020-10-01T05:31:22Z"
},
{
"tag": "5.5.0",
"kind": "minor",
"published_at": "2020-09-29T04:32:21Z"
},
{
"tag": "5.4.2",
"kind": "patch",
"published_at": "2020-08-17T04:00:30Z"
},
{
"tag": "5.4.1",
"kind": "patch",
"published_at": "2020-07-08T04:08:07Z"
},
{
"tag": "5.4.0",
"kind": "minor",
"published_at": "2020-06-30T05:22:55Z"
},
{
"tag": "5.3.2",
"kind": "patch",
"published_at": "2020-06-10T04:52:49Z"
},
{
"tag": "5.3.1",
"kind": "patch",
"published_at": "2020-05-27T04:42:29Z"
},
{
"tag": "4.9.11",
"kind": "patch",
"published_at": "2020-07-13T05:29:19Z"
},
{
"tag": "4.5.12",
"kind": "patch",
"published_at": "2020-07-14T01:53:37Z"
}
],
"recent_commits": [
{
"oid": "23137d1b2f95cdd68f304292685157ba090e7518",
"body": null,
"is_bot": false,
"headline": "Added version 8.8.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-07-15T02:36:42Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "147b97ffe8a7ccb8ea004aa0999d420d6bc27a6f",
"body": null,
"is_bot": false,
"headline": "Added version 8.7.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-07-01T03:39:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4ec295845c55ee20abd551c98bc42f1079c43c83",
"body": null,
"is_bot": false,
"headline": "Added version 8.6.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-06-03T03:28:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "265989e814097c17f3196d33244a778c4925e80b",
"body": null,
"is_bot": false,
"headline": "Added version 8.5.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-05-19T23:39:20Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4e5c520b2b6d52a6251316ab2e4af383c5e753bd",
"body": null,
"is_bot": false,
"headline": "Added version 7.9.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-05-19T23:38:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fcfc14e367d0aa6c72d018278776ef22dc2e8a8f",
"body": null,
"is_bot": false,
"headline": "Added version 8.5.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-04-29T05:18:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "268583cbd56a9ed30d38856deab8cfd48727b746",
"body": null,
"is_bot": false,
"headline": "Added version 8.4.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-03-31T06:07:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f05e38fecf76287442dd3301786955a83bbe954f",
"body": null,
"is_bot": false,
"headline": "Added version 7.9.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-02-11T03:44:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4b043a865f1978056f6649638b2e983c0624ff66",
"body": null,
"is_bot": false,
"headline": "Added version 8.3.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2026-01-14T01:01:47Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d611e7b064eab7808a0d8d581776c5884a5b687a",
"body": null,
"is_bot": false,
"headline": "Added version 8.3.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-12-17T00:53:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f7f49401cf141bbb9abaff53067db88959969a70",
"body": null,
"is_bot": false,
"headline": "Added version 8.3.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-12-10T01:56:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8d7491f2ee341c201b68cc7c3701d54703edd474",
"body": null,
"is_bot": false,
"headline": "Added version 8.2.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-11-17T03:22:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "18afc89787771029c09238e08ef5c6f6b64169b5",
"body": null,
"is_bot": false,
"headline": "Added version 8.2.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-11-06T00:55:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7dcce3851a3c9bec77b73a303c62784a98758d3d",
"body": null,
"is_bot": false,
"headline": "Added version 8.2.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-10-23T01:11:24Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d93b748fa069acc845901677a97fb701b0eec7ba",
"body": null,
"is_bot": false,
"headline": "Added version 8.1.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-09-18T08:46:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "18b9387d799663ebb9a4631e87bbd8727f4a8656",
"body": null,
"is_bot": false,
"headline": "Added version 8.1.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-09-17T15:22:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "905d51da18b6eae3b233addec8058d6a78575045",
"body": null,
"is_bot": false,
"headline": "Added version 8.1.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-09-17T04:18:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1d90c814d8821567291bc1de2eb84f4da8d6abd4",
"body": null,
"is_bot": false,
"headline": "Added version 8.0.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-08-14T02:39:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "da439f1d4bbfaab97fb59102ad29b325b8313c70",
"body": null,
"is_bot": false,
"headline": "Added version 8.0.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-07-28T04:53:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1b7f5ef6e6e11318ce3749fb60ef517cc3c2adcc",
"body": null,
"is_bot": false,
"headline": "Added version 8.0.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-07-23T02:30:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3d6219296c9a92c87337bb38fb502a469ac1167f",
"body": null,
"is_bot": false,
"headline": "Added version 7.9.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-05-29T02:22:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "41ca209b741864a96b11ca34294b2eeba873ff01",
"body": null,
"is_bot": false,
"headline": "Added version 7.9.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-05-15T01:47:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "88d1b2874256895338034dba28bf6e920aa4ba17",
"body": null,
"is_bot": false,
"headline": "Added version 7.8.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-04-09T02:06:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "841a2f73ed89df874d5abca7286c344353098f14",
"body": null,
"is_bot": false,
"headline": "Added version 7.7.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-03-19T03:36:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c92b29a72c467c07799fd09dc9e0add45cf504a1",
"body": null,
"is_bot": false,
"headline": "Added version 7.7.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-03-05T00:36:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4b04481b24137029525f6dc372706fa9d3168f14",
"body": null,
"is_bot": false,
"headline": "Added version 7.7.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-02-20T08:31:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f0b12677418f3cbb2aeffc2216bd36b0590dd418",
"body": null,
"is_bot": false,
"headline": "Added version 7.6.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2025-01-22T03:57:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0c4bc43d572ea9673468bf12cc30e8fb556550f4",
"body": null,
"is_bot": false,
"headline": "Added version 7.6.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-12-11T04:56:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3ba28fd6a4037849dbdaf7f6341493b23db9e13c",
"body": null,
"is_bot": false,
"headline": "Added version 7.5.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-11-13T03:16:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca7a694db4fff387bb6ca9775ddd3d3b5eba3d9c",
"body": null,
"is_bot": false,
"headline": "Added version 7.5.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-11-06T03:04:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e4d46be06c8d0d99f542e7199d1283850fb9192c",
"body": null,
"is_bot": false,
"headline": "Added version 7.4.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-10-10T05:50:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d48b4828c5f66dfb5171a71c47671e0d556dc2b4",
"body": null,
"is_bot": false,
"headline": "Added version 7.4.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-10-09T05:28:03Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e92ab7adaa3db1752639361ded41a7abb2d28996",
"body": null,
"is_bot": false,
"headline": "Added version 7.3.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-08-07T06:30:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db05d34dd0964dd241045cfc319c3a1bd45773e8",
"body": null,
"is_bot": false,
"headline": "Added version 7.2.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-07-03T05:25:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca4b8ce34f4d4f4c1485da90a4247886c4e45335",
"body": null,
"is_bot": false,
"headline": "Added version 7.2.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-06-19T06:08:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c587e0ce032898f6528ffc8374f1ebe3011b9158",
"body": null,
"is_bot": false,
"headline": "Added version 7.1.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-06-05T05:16:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f671e05aca24ac73298ae4922b34607b634d59f4",
"body": null,
"is_bot": false,
"headline": "Added version 7.1.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-05-22T08:18:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "05a2ae86f455231d1734f2442664b6891ec4d8dd",
"body": null,
"is_bot": false,
"headline": "Added version 7.1.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-05-08T05:24:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "863759766e2397d1f639c63d006680a9e8ba6233",
"body": null,
"is_bot": false,
"headline": "Added version 7.0.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-04-10T07:29:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c011b5164178ac5224e658bf2aed713479fc78ae",
"body": null,
"is_bot": false,
"headline": "Added version 7.0.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-03-20T05:46:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "01d1959b1200e0b872ea078e59ea5abfb5c54100",
"body": null,
"is_bot": false,
"headline": "Added version 6.8.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2024-02-08T23:33:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b0073db409746748af4fc06fbee337bb99f462d9",
"body": null,
"is_bot": false,
"headline": "Added version 6.8.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-12-11T03:21:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "15c7e5ccd1398486b773f2fc48dafc2d2ffaee8f",
"body": null,
"is_bot": false,
"headline": "Added version 6.8.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-11-29T09:44:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "56a705dcfe30211053cae2e21e5c7dc65fa7b083",
"body": null,
"is_bot": false,
"headline": "Added version 6.8.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-11-22T11:14:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2a1344eb95eb8ed512f4ad56986bfc230c8c74c7",
"body": null,
"is_bot": false,
"headline": "Added version 6.7.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-11-15T00:41:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a4c139bde17a4e8b2e84d225020cd5acc24a728a",
"body": null,
"is_bot": false,
"headline": "Added version 6.7.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-10-25T06:42:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b1ddb5ec9b0c7f5d542429a044bd303648d2d647",
"body": null,
"is_bot": false,
"headline": "Added version 6.7.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-10-19T03:04:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "02e194ec4d37aab8335332f8ac3e8d2292ba2d47",
"body": null,
"is_bot": false,
"headline": "Added version 6.7.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-08-30T11:10:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4b795ce4049e2038c79d0ec940de78f17cbe4694",
"body": null,
"is_bot": false,
"headline": "Added version 6.6.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-08-09T04:58:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6d4ca510724901084dde245481129b1cbea3aa74",
"body": null,
"is_bot": false,
"headline": "Added version 6.6.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-08-02T05:17:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "575e3a4a602619a3d9e1cd0d437ce875ff756395",
"body": null,
"is_bot": false,
"headline": "Added version 6.6.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-07-12T06:32:00Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3212d377b2132acc89c4887941e946fb61b33ee6",
"body": null,
"is_bot": false,
"headline": "Added version 6.5.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-06-19T04:36:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "31251ab0bdc693efb4d510a2d0edb07d47ca355c",
"body": null,
"is_bot": false,
"headline": "Added version 6.5.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-06-13T00:10:53Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6a37da4822eebcd2706793454b07bd891c5277a8",
"body": null,
"is_bot": false,
"headline": "Added version 6.4.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-04-26T10:48:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b2327c03fba64f8c47ec030c1f3bce98da8f7596",
"body": null,
"is_bot": false,
"headline": "Added version 6.4.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-03-29T01:33:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "488a05ddf56e844e593a3fb7da68aa5fb41f01ac",
"body": null,
"is_bot": false,
"headline": "Added version 6.4.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-03-16T00:43:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6880668bef341a0572a8354768bb1f7f53f7121c",
"body": null,
"is_bot": false,
"headline": "Added version 6.3.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2023-02-22T07:52:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bec6271ca90b2f37db48a955697746c1f58b9358",
"body": null,
"is_bot": false,
"headline": "Added version 6.3.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-12-06T02:19:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "058c00937b0128720e3663d0bfcfe49d2926cf92",
"body": null,
"is_bot": false,
"headline": "Added version 6.3.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-11-23T02:47:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "396dc0d4c4a970918e5a4322c7957c90c85c4c4f",
"body": null,
"is_bot": false,
"headline": "Added version 6.2.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-09-08T04:15:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e6c8b0aa624deb507094918b5dd689d9fea28070",
"body": null,
"is_bot": false,
"headline": "Added version 6.1.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-07-29T00:24:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "34ec83b058c32a19b62a15212995122c1ef79cdd",
"body": null,
"is_bot": false,
"headline": "Added version 6.1.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-07-27T03:47:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c6cbe460317484cb45daec0dbabfe4c1d0bf6cc8",
"body": null,
"is_bot": false,
"headline": "Added version 6.1.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-06-29T05:36:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9563ee68e845cc256cc371a6c76a750a4bab7c15",
"body": null,
"is_bot": false,
"headline": "Added version 6.0.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-05-25T04:10:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6eb0c53e09bd552740dee0ede369f6b97d6983d5",
"body": null,
"is_bot": false,
"headline": "Added version 6.0.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-04-27T03:41:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8898185c29290f52515bbd1ce53816181ce37c0f",
"body": null,
"is_bot": false,
"headline": "Added version 6.0.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-03-23T02:04:52Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "44ce3f31e18e9c70ec8210fe960fdb4941cd59f3",
"body": null,
"is_bot": false,
"headline": "Added version 6.0.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-03-03T04:28:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "dadd7f25e31680f1c6bf61d2fb0b15794f425cd1",
"body": null,
"is_bot": false,
"headline": "Added version 5.10.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2022-02-09T03:24:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ef9962f1d40abbb80a4fd4f023151fd28f891a6c",
"body": null,
"is_bot": false,
"headline": "Added version 5.10.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-11-17T04:34:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "23dbb5d218707805b74c9fe4f1e2525bcd21e689",
"body": null,
"is_bot": false,
"headline": "Added version 5.10.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-11-03T03:57:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "dbd8fefb0bbe96ed15f9af4518b078ae2c20e020",
"body": null,
"is_bot": false,
"headline": "Added version 5.10.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-10-11T03:18:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "48c665ad12ba0e4d8068ba0784026c7488aa4746",
"body": null,
"is_bot": false,
"headline": "Added version 5.9.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-09-08T03:45:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2692079b210682c63f12418ff613555efec218fd",
"body": null,
"is_bot": false,
"headline": "Added version 5.9.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-08-27T04:39:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7a479e525582d09f315c2cf2a99075d6a798b535",
"body": null,
"is_bot": false,
"headline": "Added version 5.9.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-08-26T05:43:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "dbf8c9ab481e11b660a957257c73f55e2af83b20",
"body": null,
"is_bot": false,
"headline": "Added version 5.8.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-06-23T06:52:46Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7bbf6f5f7cfa927286523a7681fd20b8489f0709",
"body": null,
"is_bot": false,
"headline": "Added version 5.8.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-05-20T02:06:43Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d2358148183b3887b9d7285b6207a8345da2adc6",
"body": null,
"is_bot": false,
"headline": "Added version 5.8.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-05-06T02:48:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8273fb332de43e7929b7b78c13c72b32871f7394",
"body": null,
"is_bot": false,
"headline": "Added version 5.7.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-03-17T01:43:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "729e1f713c3b6d526daa6cb8f7a3b3ad864c53e3",
"body": null,
"is_bot": false,
"headline": "Added version 5.7.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2021-02-10T03:44:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "310051defb85fec8581ace8b739ab7b18023db8a",
"body": null,
"is_bot": false,
"headline": "Added version 5.6.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-12-08T07:23:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f78490be294c347958f310e547582856b8aa8101",
"body": null,
"is_bot": false,
"headline": "Added version 5.6.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-11-25T03:13:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "933ded7b599708ed26b7524add7bbce21e777805",
"body": null,
"is_bot": false,
"headline": "Added version 5.6.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-11-18T05:34:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a436d254bc8d62e50be1fdb3d3e98981ab0e4c40",
"body": null,
"is_bot": false,
"headline": "Added version 5.5.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-10-01T05:31:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a2c91ba89b76a3cf1df632ab7f84a608f5ba52a0",
"body": null,
"is_bot": false,
"headline": "Added version 5.5.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-09-29T04:32:21Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "71197b6a12405d7a6e2067f725c387595bd9b3f4",
"body": null,
"is_bot": false,
"headline": "Added version 5.4.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-08-17T04:00:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "940fdcfa7aa2ade09a1ec916dadeee01baa7787a",
"body": null,
"is_bot": false,
"headline": "Added version 5.4.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-07-08T04:08:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "aa17e50a1302fdb601a56e99b7b59f7abe5ff2a6",
"body": null,
"is_bot": false,
"headline": "Added version 5.4.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-06-30T05:22:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d61fb3a8f356c3e333e0108ac539c32aeadadfb3",
"body": null,
"is_bot": false,
"headline": "Added version 5.3.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-06-10T04:52:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "680aa992f10f6ca37a700d5cfacf18beac86911b",
"body": null,
"is_bot": false,
"headline": "Added version 5.3.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-05-27T04:42:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5831401fd1681524b32992f6c485ef180ea84d2f",
"body": null,
"is_bot": false,
"headline": "Added version 5.3.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-05-21T03:33:49Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a9e4928aac63b18db3bc670661f8661133c3c205",
"body": null,
"is_bot": false,
"headline": "Added version 5.2.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-04-23T02:47:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "29bd1c22d35ad8a27982fddbe11a84a124c24b40",
"body": null,
"is_bot": false,
"headline": "Added version 5.2.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-03-25T02:45:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3653eec90aba773ebd66183fb867c77af21b2c7c",
"body": null,
"is_bot": false,
"headline": "Added version 5.2.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-02-13T04:02:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1a55d7d048c62c64c3f43734dfaa4bc0d776a035",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.6 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2020-01-28T05:08:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "26d9f929904015cc5c269418e0b86c522a8f8846",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.5 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-12-19T06:21:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7fcdd149d2e2f6013c78a965b8fab2bbe011de4f",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.4 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-12-11T03:56:56Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9332192a57fae1d717780486eabfd2d661e3b7e8",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.3 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-12-04T03:23:32Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "7587e9a7d09ea0a2ae16f6628918c1bd18df2baa",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.2 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-11-19T04:29:44Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "782aa3876f354b8d04fbf1124c4aa440cec9d199",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.1 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-10-28T06:39:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a4eca7a227e4dd97ed4356f708f0f481ab5164cb",
"body": null,
"is_bot": false,
"headline": "Added version 5.1.0 release.",
"author_name": "ephox",
"author_login": null,
"committed_at": "2019-10-17T06:09:31Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 100,
"commits_last_year": 20,
"latest_release_at": "2026-07-15T02:36:42Z",
"latest_release_tag": "8.8.0",
"releases_from_tags": true,
"days_since_last_push": 6,
"active_weeks_last_year": 16,
"days_since_latest_release": 6,
"mean_days_between_releases": 26.7
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": false,
"health_percentage": 37,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "tinymce",
"exists": true,
"license": "SEE LICENSE IN license.md",
"keywords": [
"wysiwyg",
"tinymce",
"richtext",
"javascript",
"html",
"text",
"rich editor",
"rich text editor",
"rte",
"rich text",
"contenteditable",
"editing"
],
"ecosystem": "npm",
"matches_repo": false,
"registry_url": "https://www.npmjs.com/package/tinymce",
"is_deprecated": false,
"latest_version": "8.8.0",
"repository_url": "https://github.com/tinymce/tinymce",
"versions_count": 218,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 3,
"monthly_downloads": 4489241,
"first_published_at": "2014-05-06T10:59:32.298000Z",
"latest_published_at": "2026-07-15T02:38:50.723000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 6
},
{
"name": "tinymce/tinymce",
"exists": true,
"license": "SEE LICENSE IN license.md",
"keywords": [
"text",
"javascript",
"wysiwyg",
"tinymce",
"html",
"editing",
"richtext",
"contenteditable",
"rte",
"rich editor",
"rich text editor",
"rich text"
],
"ecosystem": "packagist",
"matches_repo": true,
"registry_url": "https://packagist.org/packages/tinymce/tinymce",
"is_deprecated": false,
"latest_version": "8.8.0",
"repository_url": "https://github.com/tinymce/tinymce-dist",
"versions_count": 243,
"total_downloads": 8167016,
"dependents_count": 115,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 173352,
"first_published_at": null,
"latest_published_at": "2026-07-15T02:36:42Z",
"latest_version_yanked": null,
"days_since_latest_publish": 6
}
]
},
"popularity": {
"forks": 158,
"stars": 170,
"watchers": 24,
"fork_history": {
"days": [
{
"date": "2014-09-16",
"count": 1
},
{
"date": "2014-11-03",
"count": 1
},
{
"date": "2014-11-20",
"count": 1
},
{
"date": "2014-11-25",
"count": 1
},
{
"date": "2015-02-05",
"count": 1
},
{
"date": "2015-03-15",
"count": 1
},
{
"date": "2015-03-27",
"count": 1
},
{
"date": "2015-04-24",
"count": 1
},
{
"date": "2015-04-27",
"count": 1
},
{
"date": "2015-05-02",
"count": 1
},
{
"date": "2015-05-19",
"count": 1
},
{
"date": "2015-06-06",
"count": 1
},
{
"date": "2015-06-09",
"count": 1
},
{
"date": "2015-06-25",
"count": 1
},
{
"date": "2015-07-27",
"count": 1
},
{
"date": "2015-07-28",
"count": 1
},
{
"date": "2015-08-17",
"count": 1
},
{
"date": "2015-08-24",
"count": 1
},
{
"date": "2015-09-11",
"count": 1
},
{
"date": "2015-10-02",
"count": 1
},
{
"date": "2015-10-09",
"count": 1
},
{
"date": "2015-10-15",
"count": 1
},
{
"date": "2015-11-19",
"count": 1
},
{
"date": "2015-12-18",
"count": 1
},
{
"date": "2016-02-22",
"count": 1
},
{
"date": "2016-03-23",
"count": 1
},
{
"date": "2016-03-25",
"count": 1
},
{
"date": "2016-03-30",
"count": 1
},
{
"date": "2016-04-06",
"count": 1
},
{
"date": "2016-04-15",
"count": 1
},
{
"date": "2016-04-19",
"count": 1
},
{
"date": "2016-05-27",
"count": 1
},
{
"date": "2016-06-10",
"count": 1
},
{
"date": "2016-07-05",
"count": 1
},
{
"date": "2016-07-07",
"count": 1
},
{
"date": "2016-07-11",
"count": 2
},
{
"date": "2016-08-02",
"count": 1
},
{
"date": "2016-10-22",
"count": 1
},
{
"date": "2016-12-19",
"count": 1
},
{
"date": "2017-02-27",
"count": 1
},
{
"date": "2017-07-12",
"count": 1
},
{
"date": "2017-10-03",
"count": 1
},
{
"date": "2017-10-05",
"count": 1
},
{
"date": "2017-10-07",
"count": 1
},
{
"date": "2017-10-10",
"count": 1
},
{
"date": "2017-11-29",
"count": 1
},
{
"date": "2017-12-07",
"count": 1
},
{
"date": "2017-12-21",
"count": 1
},
{
"date": "2018-01-30",
"count": 1
},
{
"date": "2018-03-07",
"count": 1
},
{
"date": "2018-03-29",
"count": 1
},
{
"date": "2018-04-03",
"count": 1
},
{
"date": "2018-04-09",
"count": 1
},
{
"date": "2018-04-16",
"count": 1
},
{
"date": "2018-07-11",
"count": 1
},
{
"date": "2018-07-16",
"count": 1
},
{
"date": "2018-08-06",
"count": 1
},
{
"date": "2018-08-20",
"count": 1
},
{
"date": "2018-08-23",
"count": 2
},
{
"date": "2018-09-19",
"count": 1
},
{
"date": "2018-09-21",
"count": 1
},
{
"date": "2018-10-04",
"count": 1
},
{
"date": "2018-10-30",
"count": 1
},
{
"date": "2018-11-21",
"count": 1
},
{
"date": "2018-11-28",
"count": 1
},
{
"date": "2018-12-11",
"count": 1
},
{
"date": "2018-12-19",
"count": 1
},
{
"date": "2019-01-09",
"count": 2
},
{
"date": "2019-01-25",
"count": 1
},
{
"date": "2019-02-05",
"count": 1
},
{
"date": "2019-02-10",
"count": 1
},
{
"date": "2019-02-11",
"count": 1
},
{
"date": "2019-03-15",
"count": 1
},
{
"date": "2019-03-30",
"count": 1
},
{
"date": "2019-04-04",
"count": 1
},
{
"date": "2019-04-09",
"count": 1
},
{
"date": "2019-04-29",
"count": 1
},
{
"date": "2019-05-09",
"count": 1
},
{
"date": "2019-06-14",
"count": 1
},
{
"date": "2019-07-12",
"count": 1
},
{
"date": "2019-08-31",
"count": 1
},
{
"date": "2019-10-09",
"count": 1
},
{
"date": "2019-10-11",
"count": 1
},
{
"date": "2019-11-07",
"count": 1
},
{
"date": "2019-11-18",
"count": 1
},
{
"date": "2019-12-28",
"count": 1
},
{
"date": "2020-01-24",
"count": 2
},
{
"date": "2020-02-07",
"count": 1
},
{
"date": "2020-04-02",
"count": 1
},
{
"date": "2020-04-10",
"count": 1
},
{
"date": "2020-04-15",
"count": 1
},
{
"date": "2020-05-04",
"count": 1
},
{
"date": "2020-05-15",
"count": 1
},
{
"date": "2020-05-19",
"count": 1
},
{
"date": "2020-06-01",
"count": 1
},
{
"date": "2020-06-12",
"count": 1
},
{
"date": "2020-06-21",
"count": 1
},
{
"date": "2020-07-01",
"count": 1
},
{
"date": "2020-07-09",
"count": 1
},
{
"date": "2020-07-27",
"count": 1
},
{
"date": "2020-10-14",
"count": 1
},
{
"date": "2020-11-09",
"count": 1
},
{
"date": "2020-12-11",
"count": 1
},
{
"date": "2020-12-14",
"count": 1
},
{
"date": "2021-01-18",
"count": 1
},
{
"date": "2021-01-31",
"count": 1
},
{
"date": "2021-02-06",
"count": 1
},
{
"date": "2021-02-20",
"count": 1
},
{
"date": "2021-03-03",
"count": 1
},
{
"date": "2021-03-19",
"count": 1
},
{
"date": "2021-04-08",
"count": 1
},
{
"date": "2021-05-14",
"count": 1
},
{
"date": "2021-05-21",
"count": 1
},
{
"date": "2021-06-03",
"count": 1
},
{
"date": "2021-06-15",
"count": 1
},
{
"date": "2021-06-29",
"count": 1
},
{
"date": "2021-09-01",
"count": 1
},
{
"date": "2021-09-27",
"count": 1
},
{
"date": "2021-10-06",
"count": 1
},
{
"date": "2021-11-21",
"count": 1
},
{
"date": "2021-11-23",
"count": 1
},
{
"date": "2021-11-25",
"count": 1
},
{
"date": "2022-01-11",
"count": 1
},
{
"date": "2022-01-23",
"count": 1
},
{
"date": "2022-02-16",
"count": 1
},
{
"date": "2022-03-22",
"count": 1
},
{
"date": "2022-04-19",
"count": 1
},
{
"date": "2022-06-14",
"count": 1
},
{
"date": "2022-07-12",
"count": 1
},
{
"date": "2022-07-26",
"count": 1
},
{
"date": "2022-08-01",
"count": 1
},
{
"date": "2022-08-08",
"count": 1
},
{
"date": "2022-08-17",
"count": 1
},
{
"date": "2022-08-22",
"count": 2
},
{
"date": "2022-09-02",
"count": 1
},
{
"date": "2022-09-09",
"count": 1
},
{
"date": "2022-11-09",
"count": 1
},
{
"date": "2023-02-22",
"count": 1
},
{
"date": "2023-03-10",
"count": 1
},
{
"date": "2023-03-26",
"count": 1
},
{
"date": "2023-04-28",
"count": 1
},
{
"date": "2024-08-06",
"count": 1
},
{
"date": "2025-05-29",
"count": 1
},
{
"date": "2025-08-28",
"count": 1
},
{
"date": "2025-08-29",
"count": 1
},
{
"date": "2025-09-19",
"count": 1
}
],
"complete": true,
"collected": 151,
"total_forks": 158
},
"star_history": {
"days": [
{
"date": "2014-05-08",
"count": 1
},
{
"date": "2014-05-15",
"count": 1
},
{
"date": "2014-05-16",
"count": 1
},
{
"date": "2014-05-19",
"count": 1
},
{
"date": "2014-05-31",
"count": 1
},
{
"date": "2014-06-25",
"count": 1
},
{
"date": "2014-07-23",
"count": 1
},
{
"date": "2014-08-15",
"count": 1
},
{
"date": "2014-08-18",
"count": 1
},
{
"date": "2014-10-20",
"count": 1
},
{
"date": "2014-10-27",
"count": 1
},
{
"date": "2014-11-04",
"count": 1
},
{
"date": "2014-11-21",
"count": 1
},
{
"date": "2014-12-29",
"count": 1
},
{
"date": "2015-01-20",
"count": 1
},
{
"date": "2015-02-19",
"count": 1
},
{
"date": "2015-03-17",
"count": 1
},
{
"date": "2015-06-10",
"count": 1
},
{
"date": "2015-06-29",
"count": 1
},
{
"date": "2015-07-08",
"count": 1
},
{
"date": "2015-07-28",
"count": 1
},
{
"date": "2015-08-07",
"count": 1
},
{
"date": "2015-12-01",
"count": 1
},
{
"date": "2015-12-11",
"count": 2
},
{
"date": "2016-01-04",
"count": 1
},
{
"date": "2016-01-07",
"count": 1
},
{
"date": "2016-01-13",
"count": 1
},
{
"date": "2016-02-24",
"count": 1
},
{
"date": "2016-04-21",
"count": 2
},
{
"date": "2016-05-18",
"count": 1
},
{
"date": "2016-09-05",
"count": 1
},
{
"date": "2016-10-25",
"count": 1
},
{
"date": "2017-01-10",
"count": 1
},
{
"date": "2017-01-11",
"count": 1
},
{
"date": "2017-02-14",
"count": 1
},
{
"date": "2017-02-21",
"count": 1
},
{
"date": "2017-03-05",
"count": 1
},
{
"date": "2017-03-30",
"count": 1
},
{
"date": "2017-05-09",
"count": 1
},
{
"date": "2017-06-25",
"count": 1
},
{
"date": "2017-09-10",
"count": 1
},
{
"date": "2017-12-21",
"count": 1
},
{
"date": "2017-12-27",
"count": 1
},
{
"date": "2018-01-03",
"count": 1
},
{
"date": "2018-01-14",
"count": 1
},
{
"date": "2018-02-20",
"count": 1
},
{
"date": "2018-03-20",
"count": 1
},
{
"date": "2018-03-26",
"count": 1
},
{
"date": "2018-04-11",
"count": 1
},
{
"date": "2018-05-17",
"count": 1
},
{
"date": "2018-06-08",
"count": 2
},
{
"date": "2018-06-15",
"count": 1
},
{
"date": "2018-06-29",
"count": 1
},
{
"date": "2018-07-31",
"count": 2
},
{
"date": "2018-08-12",
"count": 1
},
{
"date": "2018-09-01",
"count": 1
},
{
"date": "2018-09-07",
"count": 1
},
{
"date": "2018-09-27",
"count": 1
},
{
"date": "2018-11-03",
"count": 1
},
{
"date": "2019-01-09",
"count": 1
},
{
"date": "2019-02-18",
"count": 1
},
{
"date": "2019-02-28",
"count": 1
},
{
"date": "2019-03-08",
"count": 1
},
{
"date": "2019-03-15",
"count": 1
},
{
"date": "2019-04-07",
"count": 1
},
{
"date": "2019-04-14",
"count": 1
},
{
"date": "2019-04-18",
"count": 1
},
{
"date": "2019-05-30",
"count": 1
},
{
"date": "2019-05-31",
"count": 1
},
{
"date": "2019-06-12",
"count": 1
},
{
"date": "2019-06-14",
"count": 1
},
{
"date": "2019-08-01",
"count": 1
},
{
"date": "2019-08-29",
"count": 1
},
{
"date": "2019-09-04",
"count": 1
},
{
"date": "2019-09-17",
"count": 1
},
{
"date": "2019-10-11",
"count": 1
},
{
"date": "2019-10-15",
"count": 1
},
{
"date": "2019-11-01",
"count": 1
},
{
"date": "2019-11-02",
"count": 1
},
{
"date": "2019-12-09",
"count": 1
},
{
"date": "2020-01-04",
"count": 1
},
{
"date": "2020-01-17",
"count": 1
},
{
"date": "2020-01-19",
"count": 1
},
{
"date": "2020-01-23",
"count": 1
},
{
"date": "2020-01-24",
"count": 1
},
{
"date": "2020-03-16",
"count": 1
},
{
"date": "2020-04-01",
"count": 2
},
{
"date": "2020-04-02",
"count": 1
},
{
"date": "2020-04-23",
"count": 1
},
{
"date": "2020-05-14",
"count": 1
},
{
"date": "2020-05-22",
"count": 2
},
{
"date": "2020-06-16",
"count": 1
},
{
"date": "2020-07-26",
"count": 1
},
{
"date": "2020-09-22",
"count": 1
},
{
"date": "2020-10-05",
"count": 1
},
{
"date": "2020-11-09",
"count": 1
},
{
"date": "2020-11-21",
"count": 1
},
{
"date": "2020-12-23",
"count": 1
},
{
"date": "2021-01-11",
"count": 1
},
{
"date": "2021-01-31",
"count": 1
},
{
"date": "2021-02-02",
"count": 1
},
{
"date": "2021-02-05",
"count": 1
},
{
"date": "2021-03-06",
"count": 1
},
{
"date": "2021-03-17",
"count": 1
},
{
"date": "2021-04-08",
"count": 1
},
{
"date": "2021-04-21",
"count": 1
},
{
"date": "2021-04-22",
"count": 1
},
{
"date": "2021-05-06",
"count": 1
},
{
"date": "2021-07-12",
"count": 1
},
{
"date": "2021-07-13",
"count": 1
},
{
"date": "2021-07-14",
"count": 1
},
{
"date": "2021-07-17",
"count": 1
},
{
"date": "2021-07-21",
"count": 1
},
{
"date": "2021-07-27",
"count": 1
},
{
"date": "2021-08-16",
"count": 1
},
{
"date": "2021-08-17",
"count": 1
},
{
"date": "2021-09-24",
"count": 1
},
{
"date": "2021-10-05",
"count": 1
},
{
"date": "2021-11-21",
"count": 1
},
{
"date": "2021-11-23",
"count": 1
},
{
"date": "2021-12-13",
"count": 1
},
{
"date": "2022-01-29",
"count": 1
},
{
"date": "2022-03-03",
"count": 1
},
{
"date": "2022-03-20",
"count": 1
},
{
"date": "2022-04-21",
"count": 1
},
{
"date": "2022-05-28",
"count": 1
},
{
"date": "2022-06-07",
"count": 1
},
{
"date": "2022-07-01",
"count": 1
},
{
"date": "2022-07-04",
"count": 1
},
{
"date": "2022-09-01",
"count": 1
},
{
"date": "2022-09-28",
"count": 1
},
{
"date": "2022-12-04",
"count": 1
},
{
"date": "2023-02-22",
"count": 1
},
{
"date": "2023-02-25",
"count": 1
},
{
"date": "2023-04-21",
"count": 1
},
{
"date": "2023-05-02",
"count": 1
},
{
"date": "2023-05-27",
"count": 1
},
{
"date": "2023-05-31",
"count": 1
},
{
"date": "2023-06-26",
"count": 1
},
{
"date": "2023-08-13",
"count": 1
},
{
"date": "2023-09-08",
"count": 1
},
{
"date": "2023-10-16",
"count": 1
},
{
"date": "2023-10-23",
"count": 1
},
{
"date": "2023-12-09",
"count": 1
},
{
"date": "2024-02-25",
"count": 1
},
{
"date": "2024-03-25",
"count": 1
},
{
"date": "2024-04-11",
"count": 1
},
{
"date": "2024-07-07",
"count": 1
},
{
"date": "2024-10-25",
"count": 1
},
{
"date": "2024-10-29",
"count": 1
},
{
"date": "2024-12-27",
"count": 1
},
{
"date": "2025-02-24",
"count": 1
},
{
"date": "2025-02-28",
"count": 1
},
{
"date": "2025-06-09",
"count": 1
},
{
"date": "2025-07-03",
"count": 1
},
{
"date": "2025-08-29",
"count": 1
},
{
"date": "2025-10-20",
"count": 1
},
{
"date": "2025-12-17",
"count": 1
},
{
"date": "2026-01-12",
"count": 1
},
{
"date": "2026-01-15",
"count": 1
},
{
"date": "2026-02-06",
"count": 1
},
{
"date": "2026-02-21",
"count": 1
},
{
"date": "2026-06-19",
"count": 1
}
],
"complete": true,
"collected": 169,
"total_stars": 170
},
"open_issues_and_prs": 1
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [],
"toolchain_manifests": [],
"largest_source_bytes": 1895997,
"source_files_sampled": 221,
"oversized_source_files": 22,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"composer.json",
"package.json"
],
"advisories": {
"error": "No resolved dependencies to assess",
"scope": "repository_graph",
"source": null,
"findings": [],
"collected": false,
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm",
"packagist"
],
"dependencies": [],
"all_dependencies": {
"error": null,
"source": "github-sbom",
"packages": [],
"collected": true,
"truncated": false,
"total_count": 0,
"direct_count": 0,
"indirect_count": 0
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 0,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 12
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "spocke",
"commits": 74,
"avatar_url": "https://avatars.githubusercontent.com/u/115879?v=4"
},
{
"type": "User",
"login": "jhaines",
"commits": 1,
"avatar_url": "https://avatars.githubusercontent.com/u/2252638?v=4"
}
],
"contributors_sampled": 2,
"top_contributor_share": 0.987
},
"quality_signals": {
"has_ci": false,
"has_tests": false,
"ci_workflows": [],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 10,
"reason": "project has 3 contributing companies or organizations -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 9,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 5,
"reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 10,
"reason": "0 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "23137d1b2f95cdd68f304292685157ba090e7518",
"ran_at": "2026-07-21T20:25:32Z",
"aggregate_score": 3.5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/tinymce/tinymce-dist",
"host": "github.com",
"name": "tinymce-dist",
"owner": "tinymce"
},
"metrics": {
"overall": {
"key": "overall",
"band": "at_risk",
"name": "Overall health",
"note": null,
"notes": [],
"value": 48,
"inputs": {
"security": 35,
"vitality": 74,
"community": 61,
"governance": 45,
"engineering": 21
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 74,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 64,
"inputs": {
"commits_last_year": 20,
"human_commit_share": 1,
"days_since_last_push": 6,
"active_weeks_last_year": 16
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 6 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 6
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "16/52 weeks with commits",
"points": 11.1,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 16
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "20 commits in the last year",
"points": 11.9,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 20
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 5,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 88,
"inputs": {
"releases_count": 100,
"latest_release_tag": "8.8.0",
"releases_from_tags": true,
"days_since_latest_release": 6,
"mean_days_between_releases": 26.7
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "100 version tags (no GitHub releases)",
"points": 16.2,
"status": "partial",
"details": [
{
"code": "version_tags_no_releases",
"params": {
"count": 100
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 6 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 6
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~26.7 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 26.7
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 6,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 6 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 6
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "moderate",
"name": "Community & Adoption",
"value": 61,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "moderate",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 62,
"inputs": {
"forks": 158,
"stars": 170,
"watchers": 24,
"growth_state": "organic",
"growth_factor_pct": 100
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "170 stars",
"points": 36.1,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 170
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "158 forks",
"points": 18.3,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 158
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "24 watchers",
"points": 7.6,
"status": "partial",
"details": [
{
"code": "watchers",
"params": {
"count": 24
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "at_risk",
"name": "Community health",
"note": null,
"notes": [],
"value": 44,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "license file present, not a recognized license",
"points": 16.9,
"status": "partial",
"details": [
{
"code": "license_custom",
"params": {}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "good",
"name": "Ecosystem adoption (downloads)",
"note": null,
"notes": [],
"value": 84,
"inputs": {
"packages": [
"tinymce/tinymce"
],
"dependents": 115,
"ecosystems": "packagist",
"total_downloads": 8167016,
"monthly_downloads": 173352
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "173,352 downloads/month across packagist",
"points": 69.9,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 173352,
"ecosystems": "packagist"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "115 packages depend on it",
"points": 13.8,
"status": "partial",
"details": [
{
"code": "registry_dependents",
"params": {
"count": 115
}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "at_risk",
"name": "Sustainability & Governance",
"value": 45,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 22,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 2,
"top_contributor_share": 0.987
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 99% of commits",
"points": 0.3,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 99
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "2 contributors",
"points": 2.7,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 2
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 3 contributing companies or organizations -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "critical",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"merged_prs": 0,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 12
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "0/12 decided PRs merged",
"points": 0,
"status": "missed",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 0,
"decided": 12
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "good",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 74,
"inputs": {
"followers": 418,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "tinymce",
"public_repos": 102,
"account_age_days": 6173
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "418 followers of tinymce",
"points": 18.9,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 418,
"login": "tinymce"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "102 public repos, account ~16 yr old",
"points": 25,
"status": "met",
"details": [
{
"code": "public_repos",
"params": {
"count": 102
}
},
{
"code": "account_age_years",
"params": {
"years": 16
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"tinymce/tinymce"
],
"ecosystems": "packagist",
"any_deprecated": false,
"min_days_since_publish": 6
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on packagist",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "packagist"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 6 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 6
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "243 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 243
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "critical",
"name": "Engineering Quality",
"value": 21,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "critical",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_ci": false,
"has_tests": false,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"topics": [
"tinymce"
],
"has_wiki": false,
"homepage": null,
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": "1 topics",
"points": 10,
"status": "met",
"details": [
{
"code": "topics_count",
"params": {
"count": 1
}
}
],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "at_risk",
"name": "Security",
"value": 35,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "at_risk",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): CI-Tests, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"ci_tests",
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 35,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 12,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 6,
"scorecard_aggregate": 3.5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 3 contributing companies or organizations -- score normalized to 10",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.2,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
"points": 3.8,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "0 existing vulnerabilities detected",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 1
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "critical",
"name": "AI Readiness",
"value": 10,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "0 of 100 human commits state their intent (structured subject or explanatory body)",
"points": 0,
"status": "missed",
"details": [
{
"code": "legible_history",
"params": {
"legible": 0,
"sampled": 100
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "critical",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_nix": false,
"has_tests": false,
"lockfiles": [],
"has_dockerfile": false,
"typed_language": false,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [],
"agent_commit_share": 0,
"toolchain_manifests": [],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no agent-authored commits among the last 100",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_authored_commits",
"params": {
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no automated dependency updates observed",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_dependency_automation",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "moderate",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"primary_language": "JavaScript",
"largest_source_bytes": 1895997,
"source_files_sampled": 221,
"oversized_source_files": 22
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "JavaScript without a type-check config",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_typecheck_config_language",
"params": {
"language": "JavaScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "22/221 source files over 60KB",
"points": 49.5,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 221,
"oversized": 22
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring",
"deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead"
],
"report_type": "repository",
"generated_at": "2026-07-21T20:25:38.248671Z",
"schema_version": "0.23.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/t/tinymce/tinymce-dist.svg",
"full_name": "tinymce/tinymce-dist",
"license_state": "custom",
"license_spdx": null
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.23.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — npm, Packagist.