Публічний реєстр
Звіт про здоров'я програмного забезпеченнясхема 0.23.0 · метрики 1.13.0 · 2026-07-21 20:25 UTC

tinymce / tinymce-dist

Official TinyMCE repository for production usage in package managers

JavaScript · CSSВласна ліцензія★ 170 зірок⑂ 158 форківз трав. 2014 р.Переглянути на GitHub ↗

tinymce/tinymce-dist має індекс здоров’я 48 зі 100, що відповідає смузі «У зоні ризику». Найвищий показник — Vitality (74/100), найнижчий — AI Readiness (10/100). Останнє оновлення було 6 днів тому. Більшість нещодавньої роботи виконує один учасник.

48
загалом / 100
У зоні ризику

Індекс здоров'я програмного забезпечення

Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.

48
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
ЖиттєздатністьСпільнота тавпровадженняСталість таврядуванняІнженернаякістьБезпекаГотовність доШІ

Профіль оцінок

Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.

Власність

TinyОрганізація
418 підписників102 публічні репозиторіїз серп. 2009 р.

За цим репозиторієм стоїть організація — спільна, підзвітна опіка, здатна пережити будь-якого окремого мейнтейнера.

Пакетні екосистеми

РеєстрПакетВерсіяЗавантажень / місВерсіїОстання публікаціяТеги
npmtinymceвказує на інший репозиторій — не оцінюється8.8.04 489 2412186 днів томуwysiwygtinymcerichtextjavascripthtmltextrich-editorrich-text-editorrterich-textcontenteditableediting
Packagisttinymce/tinymce8.8.0173 3522436 днів томуtextjavascriptwysiwygtinymcehtmleditingrichtextcontenteditablerterich-editorrich-text-editorrich-text

Метрики за категоріями

Життєздатність

Чи живий проєкт — чи пишеться код і чи виходять релізи?

74Добрий · 22% загального індексу
Як обчислюється оцінка
36/36Свіжість push — останній push 6 дн. тому
11.1/36Ритм комітів — 16/52 тижнів із комітами
11.9/18Обсяг комітів — 20 комітів за останній рік
5/10OpenSSF Scorecard: Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
Використані вхідні дані
commits_last_year20
human_commit_share1
days_since_last_push6
active_weeks_last_year16
Як обчислюється оцінка
16.2/27Випускає релізи — 100 тегів версій (без релізів GitHub)
36/36Свіжість релізів — останній реліз 6 дн. тому
27/27Ритм релізів — реліз кожні ~26,7 дн.
0/10OpenSSF Scorecard: Signed-Releases — немає даних
Використані вхідні дані
releases_count100
latest_release_tag8.8.0
releases_from_tagsтак
days_since_latest_release6
mean_days_between_releases26,7
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: Signed-Releases. Залишкові ваги перенормовано.

Спільнота та впровадження

Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?

61Помірний · 18% загального індексу
Як обчислюється оцінка
36.1/60Зірки — 170 зірок
18.3/25Форки — 158 форків
7.6/15Спостерігачі — 24 спостерігачів
Використані вхідні дані
forks158
stars170
watchers24
growth_stateorganic
growth_factor_pct100

Здоров'я спільноти

44У зоні ризику
Як обчислюється оцінка
22.5/22.5README
16.9/22.5Ліцензія — файл ліцензії наявний, не є визнаною ліцензією
0/18Настанови CONTRIBUTING
0/13.5Кодекс поведінки
0/7.2Шаблон issue
0/6.3Шаблон PR
Використані вхідні дані
has_readmeтак
has_licenseтак
has_contributingні
has_issue_templateні
has_code_of_conductні
has_pull_request_templateні
Як обчислюється оцінка
69.9/80Щомісячні завантаження — 173 352 завантажень/місяць у packagist
13.8/20Залежні пакети в реєстрі — залежних пакетів: 115
Використані вхідні дані
packagestinymce/tinymce
dependents115
ecosystemspackagist
total_downloads8 167 016
monthly_downloads173 352

Сталість та врядування

Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?

45У зоні ризику · 24% загального індексу
Як обчислюється оцінка
9/54Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів
0.3/22.5Розподіл комітів — головний контриб’ютор — автор 99% комітів
2.7/13.5Широта контриб’юторів — 2 контриб’юторів
10/10OpenSSF Scorecard: Contributors — project has 3 contributing companies or organizations -- score normalized to 10
Використані вхідні дані
bus_factor1
contributors_sampled2
top_contributor_share0,987
Як обчислюється оцінка
0/46.8Вирішення issue — немає issue або даних
0/38.3Прийняття PR — злито 0/12 вирішених PR
0/15OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0
Використані вхідні дані
merged_prs0
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs12
Виключено з оцінювання (немає даних або не застосовно): Вирішення issue. Залишкові ваги перенормовано.
Як обчислюється оцінка
30/30Підтримка власника — у власності організації
0/20Верифікований домен
18.9/25Охоплення власника — 418 підписників у tinymce
25/25Послужний список — 102 публічних репозиторіїв, вік облікового запису ~16 р.
Використані вхідні дані
followers418
owner_typeOrganization
is_verified
owner_logintinymce
public_repos102
account_age_days6 173

Супровід пакетів

100Відмінний
Як обчислюється оцінка
25/25Опубліковано й доступно — 1 пакет(ів) у packagist
35/35Свіжість публікацій — остання публікація 6 дн. тому
20/20Історія версій — 243 опублікованих версій
20/20Не застарілий — активний, не deprecated і не yanked
Використані вхідні дані
packagestinymce/tinymce
ecosystemspackagist
any_deprecatedні
min_days_since_publish6

Інженерна якість

Чи наявні базові інженерні практики та документація?

21Критичний · 20% загального індексу
Як обчислюється оцінка
0/24Процеси CI
0/24Наявні тести
0/16Конфігурація лінтера
0/9.6Pre-commit-хуки
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — немає даних
Використані вхідні дані
has_ciні
has_testsні
has_editorconfigні
has_linter_configні
has_precommit_configні
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: CI-Tests. Залишкові ваги перенормовано.

Документація

50Помірний
Як обчислюється оцінка
30/30README
0/25Каталог документації
0/15Сайт документації / домашня сторінка
10/10Опис репозиторію
10/10Теми — 1 тем
0/10Wiki
Використані вхідні дані
topicstinymce
has_wikiні
homepage
has_readmeтак
has_docs_dirні
has_descriptionтак

Безпека

Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?

35У зоні ризику · 16% загального індексу

Стан безпеки

35У зоні ризику
Як обчислюється оцінка
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
0/2.5CI-Tests — немає даних
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/30 approved changesets -- score normalized to 0
2.5/2.5Contributors — project has 3 contributing companies or organizations -- score normalized to 10
0/10Dangerous-Workflow — немає даних
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
2.2/2.5Ліцензія — license file detected
3.8/7.5Maintained — 6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
0/5Packaging — немає даних
0/5Pinned-Dependencies — немає даних
0/5SAST — no SAST tool detected
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — немає даних
0/7.5Token-Permissions — немає даних
7.5/7.5Vulnerabilities — 0 existing vulnerabilities detected
Використані вхідні дані
sourceopenssf_scorecard
checks_evaluated12
scorecard_versionv5.5.0
checks_inconclusive6
scorecard_aggregate3,5
Виключено з оцінювання (немає даних або не застосовно): ci_tests, dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Залишкові ваги перенормовано.

Готовність до ШІ

Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.

10Критичний · 0% загального індексу
Як обчислюється оцінка
0/45Інструкції для агентів — немає CLAUDE.md / AGENTS.md / правил редактора
0/15Машиночитана документація (llms.txt)
0/40Читабельна історія комітів — намір зазначено у 0 з 100 людських комітів (структурований заголовок або пояснювальний текст)
Використані вхідні дані
has_llms_txtні
legible_history_share0
agent_instruction_files
agent_instruction_max_bytes
Як обчислюється оцінка
0/18Розгортання однією командою
0/22Автоматизовані тести
0/11Конфігурація лінтера / форматера
0/11Статична перевірка типів
0/10Відтворюване середовище
0/10Підтверджена практика роботи з агентами — серед останніх 100 комітів немає створених агентом
0/8Автоматизоване супроводження — автоматичних оновлень залежностей не виявлено
0/10OpenSSF Scorecard: Pinned-Dependencies — немає даних
Використані вхідні дані
has_nixні
has_testsні
lockfiles
has_dockerfileні
typed_languageні
bootstrap_files
has_devcontainerні
has_linter_configні
typecheck_configs
agent_commit_share0
toolchain_manifests
dependency_bot_commit_share0
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: Pinned-Dependencies. Залишкові ваги перенормовано.
Як обчислюється оцінка
0/45Типізований код — JavaScript без конфігурації перевірки типів
49.5/55Керовані розміри файлів — 22/221 файлів вихідного коду понад 60 КБ
Використані вхідні дані
primary_languageJavaScript
largest_source_bytes1 895 997
source_files_sampled221
oversized_source_files22

Ключові факти

170зірок GitHub
2контриб'юторів
20комітів за останні 12 місяців
6днів від останнього пушу
100релізів
1бас-фактор
0відкритих issue
npm, Packagistпакетних екосистем

Попередження щодо збору даних

  • npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring
  • deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead

Докладніше

Історія зірок і форків 170 ★ / 158 ⇿
170Зірки
158Форки
98Релізи

Коли додано кожну зірку й форк — зібрано з GitHub і згруповано за днями. Кумулятивне зростання розміщено просто над денними додаваннями, з яких воно складається, тож їх видно одне проти одного: рівномірне органічне накопичення виглядає зовсім інакше, ніж різкий короткочасний сплеск. Там, де цю різницю можна виміряти, її подано як автентичність росту.

0408012016020016915142014-052020-052026-06
Мажорні 3Мінорні 30Патчі 65

Кожна точка охоплює 12 днів.

OpenSSF Scorecard 3.5 / 10
3.5сукупно

Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).Scorecard v5.5.0 · 2026-07-21 20:25 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
н/дCI-Testsno pull request found
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/30 approved changesets -- score normalized to 0
10Contributorsproject has 3 contributing companies or organizations -- score normalized to 10
н/дDangerous-Workflowno workflows found
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
9Licenselicense file detected
5Maintained6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5
н/дPackagingpackaging workflow not detected
н/дPinned-Dependenciesno dependencies found
0SASTno SAST tool detected
0Security-Policysecurity policy file not detected
н/дSigned-Releasesno releases found
н/дToken-PermissionsNo tokens found
10Vulnerabilities0 existing vulnerabilities detected
Усі залежності 0

Повний розв'язаний набір залежностей із графа залежностей GitHub: 0 прямих і 0 непрямих (транзитивних) пакетів. Транзитивне замикання є повним, коли в репозиторії закомічено lockfile.

РеєстрПакетВерсіяЗв'язок
Сповіщення про залежності не оцінено

Звірка сповіщень не відбулася для цього звіту: No resolved dependencies to assess

Звіт у форматі JSON машиночитний
{
  "data": {
    "repo": {
      "topics": [
        "tinymce"
      ],
      "is_fork": false,
      "size_kb": 51419,
      "has_wiki": false,
      "homepage": null,
      "languages": {
        "CSS": 1221547,
        "JavaScript": 5155732,
        "TypeScript": 270304
      },
      "pushed_at": "2026-07-15T02:36:44Z",
      "created_at": "2014-05-06T10:57:12Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-15T02:36:49Z",
      "description": "Official TinyMCE repository for production usage in package managers",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": null,
      "default_branch": "master",
      "license_spdx_raw": "NOASSERTION",
      "primary_language": "JavaScript",
      "significant_languages": [
        "JavaScript",
        "CSS"
      ]
    },
    "owner": {
      "blog": "https://www.tiny.cloud/",
      "name": "Tiny",
      "type": "Organization",
      "login": "tinymce",
      "company": null,
      "location": null,
      "followers": 418,
      "avatar_url": "https://avatars.githubusercontent.com/u/119815?v=4",
      "created_at": "2009-08-26T18:15:21Z",
      "is_verified": null,
      "public_repos": 102,
      "account_age_days": 6173
    },
    "license": {
      "state": "custom",
      "spdx_id": null,
      "raw_spdx": "NOASSERTION",
      "file_present": true,
      "scorecard_found": true,
      "profile_has_license": true
    },
    "activity": {
      "releases": [
        {
          "tag": "8.8.0",
          "kind": "minor",
          "published_at": "2026-07-15T02:36:42Z"
        },
        {
          "tag": "8.7.0",
          "kind": "minor",
          "published_at": "2026-07-01T03:39:33Z"
        },
        {
          "tag": "8.6.0",
          "kind": "minor",
          "published_at": "2026-06-03T03:28:15Z"
        },
        {
          "tag": "8.5.1",
          "kind": "patch",
          "published_at": "2026-05-19T23:39:20Z"
        },
        {
          "tag": "8.5.0",
          "kind": "minor",
          "published_at": "2026-04-29T05:18:45Z"
        },
        {
          "tag": "8.4.0",
          "kind": "minor",
          "published_at": "2026-03-31T06:07:53Z"
        },
        {
          "tag": "8.3.2",
          "kind": "patch",
          "published_at": "2026-01-14T01:01:47Z"
        },
        {
          "tag": "8.3.1",
          "kind": "patch",
          "published_at": "2025-12-17T00:53:22Z"
        },
        {
          "tag": "8.3.0",
          "kind": "minor",
          "published_at": "2025-12-10T01:56:11Z"
        },
        {
          "tag": "8.2.2",
          "kind": "patch",
          "published_at": "2025-11-17T03:22:11Z"
        },
        {
          "tag": "8.2.1",
          "kind": "patch",
          "published_at": "2025-11-06T00:55:35Z"
        },
        {
          "tag": "8.2.0",
          "kind": "minor",
          "published_at": "2025-10-23T01:11:24Z"
        },
        {
          "tag": "8.1.2",
          "kind": "patch",
          "published_at": "2025-09-18T08:46:07Z"
        },
        {
          "tag": "8.1.1",
          "kind": "patch",
          "published_at": "2025-09-17T15:22:02Z"
        },
        {
          "tag": "8.1.0",
          "kind": "minor",
          "published_at": "2025-09-17T04:18:06Z"
        },
        {
          "tag": "8.0.2",
          "kind": "patch",
          "published_at": "2025-08-14T02:39:07Z"
        },
        {
          "tag": "8.0.1",
          "kind": "patch",
          "published_at": "2025-07-28T04:53:13Z"
        },
        {
          "tag": "8.0.0",
          "kind": "major",
          "published_at": "2025-07-23T02:30:15Z"
        },
        {
          "tag": "7.9.3",
          "kind": "patch",
          "published_at": "2026-05-19T23:38:56Z"
        },
        {
          "tag": "7.9.2",
          "kind": "patch",
          "published_at": "2026-02-11T03:44:54Z"
        },
        {
          "tag": "7.9.1",
          "kind": "patch",
          "published_at": "2025-05-29T02:22:36Z"
        },
        {
          "tag": "7.9.0",
          "kind": "minor",
          "published_at": "2025-05-15T01:47:37Z"
        },
        {
          "tag": "7.8.0",
          "kind": "minor",
          "published_at": "2025-04-09T02:06:27Z"
        },
        {
          "tag": "7.7.2",
          "kind": "patch",
          "published_at": "2025-03-19T03:36:58Z"
        },
        {
          "tag": "7.7.1",
          "kind": "patch",
          "published_at": "2025-03-05T00:36:32Z"
        },
        {
          "tag": "7.7.0",
          "kind": "minor",
          "published_at": "2025-02-20T08:31:02Z"
        },
        {
          "tag": "7.6.1",
          "kind": "patch",
          "published_at": "2025-01-22T03:57:00Z"
        },
        {
          "tag": "7.6.0",
          "kind": "minor",
          "published_at": "2024-12-11T04:56:37Z"
        },
        {
          "tag": "7.5.1",
          "kind": "patch",
          "published_at": "2024-11-13T03:16:27Z"
        },
        {
          "tag": "7.5.0",
          "kind": "minor",
          "published_at": "2024-11-06T03:04:46Z"
        },
        {
          "tag": "7.4.1",
          "kind": "patch",
          "published_at": "2024-10-10T05:50:45Z"
        },
        {
          "tag": "7.4.0",
          "kind": "minor",
          "published_at": "2024-10-09T05:28:03Z"
        },
        {
          "tag": "7.3.0",
          "kind": "minor",
          "published_at": "2024-08-07T06:30:33Z"
        },
        {
          "tag": "7.2.1",
          "kind": "patch",
          "published_at": "2024-07-03T05:25:26Z"
        },
        {
          "tag": "7.2.0",
          "kind": "minor",
          "published_at": "2024-06-19T06:08:58Z"
        },
        {
          "tag": "7.1.2",
          "kind": "patch",
          "published_at": "2024-06-05T05:16:22Z"
        },
        {
          "tag": "7.1.1",
          "kind": "patch",
          "published_at": "2024-05-22T08:18:50Z"
        },
        {
          "tag": "7.1.0",
          "kind": "minor",
          "published_at": "2024-05-08T05:24:56Z"
        },
        {
          "tag": "7.0.1",
          "kind": "patch",
          "published_at": "2024-04-10T07:29:34Z"
        },
        {
          "tag": "7.0.0",
          "kind": "major",
          "published_at": "2024-03-20T05:46:56Z"
        },
        {
          "tag": "6.8.6",
          "kind": "patch",
          "published_at": "2025-05-29T02:36:52Z"
        },
        {
          "tag": "6.8.5",
          "kind": "patch",
          "published_at": "2024-10-10T06:06:02Z"
        },
        {
          "tag": "6.8.4",
          "kind": "patch",
          "published_at": "2024-06-19T09:28:48Z"
        },
        {
          "tag": "6.8.3",
          "kind": "patch",
          "published_at": "2024-02-08T23:33:30Z"
        },
        {
          "tag": "6.8.2",
          "kind": "patch",
          "published_at": "2023-12-11T03:21:56Z"
        },
        {
          "tag": "6.8.1",
          "kind": "patch",
          "published_at": "2023-11-29T09:44:11Z"
        },
        {
          "tag": "6.8.0",
          "kind": "minor",
          "published_at": "2023-11-22T11:14:25Z"
        },
        {
          "tag": "6.7.3",
          "kind": "patch",
          "published_at": "2023-11-15T00:41:51Z"
        },
        {
          "tag": "6.7.2",
          "kind": "patch",
          "published_at": "2023-10-25T06:42:18Z"
        },
        {
          "tag": "6.7.1",
          "kind": "patch",
          "published_at": "2023-10-19T03:04:57Z"
        },
        {
          "tag": "6.7.0",
          "kind": "minor",
          "published_at": "2023-08-30T11:10:35Z"
        },
        {
          "tag": "6.6.2",
          "kind": "patch",
          "published_at": "2023-08-09T04:58:32Z"
        },
        {
          "tag": "6.6.1",
          "kind": "patch",
          "published_at": "2023-08-02T05:17:12Z"
        },
        {
          "tag": "6.6.0",
          "kind": "minor",
          "published_at": "2023-07-12T06:32:00Z"
        },
        {
          "tag": "6.5.1",
          "kind": "patch",
          "published_at": "2023-06-19T04:36:46Z"
        },
        {
          "tag": "6.5.0",
          "kind": "minor",
          "published_at": "2023-06-13T00:10:53Z"
        },
        {
          "tag": "6.4.2",
          "kind": "patch",
          "published_at": "2023-04-26T10:48:15Z"
        },
        {
          "tag": "6.4.1",
          "kind": "patch",
          "published_at": "2023-03-29T01:33:40Z"
        },
        {
          "tag": "6.4.0",
          "kind": "minor",
          "published_at": "2023-03-16T00:43:05Z"
        },
        {
          "tag": "6.3.2",
          "kind": "patch",
          "published_at": "2023-02-22T07:52:19Z"
        },
        {
          "tag": "6.3.1",
          "kind": "patch",
          "published_at": "2022-12-06T02:19:08Z"
        },
        {
          "tag": "6.3.0",
          "kind": "minor",
          "published_at": "2022-11-23T02:47:17Z"
        },
        {
          "tag": "6.2.0",
          "kind": "minor",
          "published_at": "2022-09-08T04:15:30Z"
        },
        {
          "tag": "6.1.2",
          "kind": "patch",
          "published_at": "2022-07-29T00:24:40Z"
        },
        {
          "tag": "6.1.1",
          "kind": "patch",
          "published_at": "2022-07-27T03:47:09Z"
        },
        {
          "tag": "6.1.0",
          "kind": "minor",
          "published_at": "2022-06-29T05:36:09Z"
        },
        {
          "tag": "6.0.3",
          "kind": "patch",
          "published_at": "2022-05-25T04:10:33Z"
        },
        {
          "tag": "6.0.2",
          "kind": "patch",
          "published_at": "2022-04-27T03:41:08Z"
        },
        {
          "tag": "6.0.1",
          "kind": "patch",
          "published_at": "2022-03-23T02:04:52Z"
        },
        {
          "tag": "6.0.0",
          "kind": "major",
          "published_at": "2022-03-03T04:28:36Z"
        },
        {
          "tag": "5.10.9",
          "kind": "patch",
          "published_at": "2023-11-15T00:42:08Z"
        },
        {
          "tag": "5.10.8",
          "kind": "patch",
          "published_at": "2023-10-19T03:02:47Z"
        },
        {
          "tag": "5.10.7",
          "kind": "patch",
          "published_at": "2022-12-07T03:50:54Z"
        },
        {
          "tag": "5.10.6",
          "kind": "patch",
          "published_at": "2022-10-19T02:16:29Z"
        },
        {
          "tag": "5.10.5",
          "kind": "patch",
          "published_at": "2022-05-25T04:08:16Z"
        },
        {
          "tag": "5.10.4",
          "kind": "patch",
          "published_at": "2022-04-27T03:39:26Z"
        },
        {
          "tag": "5.10.3",
          "kind": "patch",
          "published_at": "2022-02-09T03:24:06Z"
        },
        {
          "tag": "5.10.2",
          "kind": "patch",
          "published_at": "2021-11-17T04:34:27Z"
        },
        {
          "tag": "5.10.1",
          "kind": "patch",
          "published_at": "2021-11-03T03:57:12Z"
        },
        {
          "tag": "5.10.0",
          "kind": "minor",
          "published_at": "2021-10-11T03:18:15Z"
        },
        {
          "tag": "5.9.2",
          "kind": "patch",
          "published_at": "2021-09-08T03:45:09Z"
        },
        {
          "tag": "5.9.1",
          "kind": "patch",
          "published_at": "2021-08-27T04:39:18Z"
        },
        {
          "tag": "5.9.0",
          "kind": "minor",
          "published_at": "2021-08-26T05:43:13Z"
        },
        {
          "tag": "5.8.2",
          "kind": "patch",
          "published_at": "2021-06-23T06:52:46Z"
        },
        {
          "tag": "5.8.1",
          "kind": "patch",
          "published_at": "2021-05-20T02:06:43Z"
        },
        {
          "tag": "5.8.0",
          "kind": "minor",
          "published_at": "2021-05-06T02:48:11Z"
        },
        {
          "tag": "5.7.1",
          "kind": "patch",
          "published_at": "2021-03-17T01:43:23Z"
        },
        {
          "tag": "5.7.0",
          "kind": "minor",
          "published_at": "2021-02-10T03:44:04Z"
        },
        {
          "tag": "5.6.2",
          "kind": "patch",
          "published_at": "2020-12-08T07:23:49Z"
        },
        {
          "tag": "5.6.1",
          "kind": "patch",
          "published_at": "2020-11-25T03:13:16Z"
        },
        {
          "tag": "5.6.0",
          "kind": "minor",
          "published_at": "2020-11-18T05:34:55Z"
        },
        {
          "tag": "5.5.1",
          "kind": "patch",
          "published_at": "2020-10-01T05:31:22Z"
        },
        {
          "tag": "5.5.0",
          "kind": "minor",
          "published_at": "2020-09-29T04:32:21Z"
        },
        {
          "tag": "5.4.2",
          "kind": "patch",
          "published_at": "2020-08-17T04:00:30Z"
        },
        {
          "tag": "5.4.1",
          "kind": "patch",
          "published_at": "2020-07-08T04:08:07Z"
        },
        {
          "tag": "5.4.0",
          "kind": "minor",
          "published_at": "2020-06-30T05:22:55Z"
        },
        {
          "tag": "5.3.2",
          "kind": "patch",
          "published_at": "2020-06-10T04:52:49Z"
        },
        {
          "tag": "5.3.1",
          "kind": "patch",
          "published_at": "2020-05-27T04:42:29Z"
        },
        {
          "tag": "4.9.11",
          "kind": "patch",
          "published_at": "2020-07-13T05:29:19Z"
        },
        {
          "tag": "4.5.12",
          "kind": "patch",
          "published_at": "2020-07-14T01:53:37Z"
        }
      ],
      "recent_commits": [
        {
          "oid": "23137d1b2f95cdd68f304292685157ba090e7518",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-07-15T02:36:42Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "147b97ffe8a7ccb8ea004aa0999d420d6bc27a6f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-07-01T03:39:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4ec295845c55ee20abd551c98bc42f1079c43c83",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-06-03T03:28:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "265989e814097c17f3196d33244a778c4925e80b",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-05-19T23:39:20Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4e5c520b2b6d52a6251316ab2e4af383c5e753bd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-05-19T23:38:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "fcfc14e367d0aa6c72d018278776ef22dc2e8a8f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-04-29T05:18:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "268583cbd56a9ed30d38856deab8cfd48727b746",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-03-31T06:07:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f05e38fecf76287442dd3301786955a83bbe954f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-02-11T03:44:54Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b043a865f1978056f6649638b2e983c0624ff66",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2026-01-14T01:01:47Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d611e7b064eab7808a0d8d581776c5884a5b687a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-12-17T00:53:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f7f49401cf141bbb9abaff53067db88959969a70",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-12-10T01:56:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8d7491f2ee341c201b68cc7c3701d54703edd474",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-11-17T03:22:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18afc89787771029c09238e08ef5c6f6b64169b5",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-11-06T00:55:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7dcce3851a3c9bec77b73a303c62784a98758d3d",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-10-23T01:11:24Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d93b748fa069acc845901677a97fb701b0eec7ba",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-18T08:46:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "18b9387d799663ebb9a4631e87bbd8727f4a8656",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-17T15:22:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "905d51da18b6eae3b233addec8058d6a78575045",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-09-17T04:18:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1d90c814d8821567291bc1de2eb84f4da8d6abd4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-08-14T02:39:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "da439f1d4bbfaab97fb59102ad29b325b8313c70",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-07-28T04:53:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1b7f5ef6e6e11318ce3749fb60ef517cc3c2adcc",
          "body": null,
          "is_bot": false,
          "headline": "Added version 8.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-07-23T02:30:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3d6219296c9a92c87337bb38fb502a469ac1167f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-05-29T02:22:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "41ca209b741864a96b11ca34294b2eeba873ff01",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.9.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-05-15T01:47:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "88d1b2874256895338034dba28bf6e920aa4ba17",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-04-09T02:06:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "841a2f73ed89df874d5abca7286c344353098f14",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-03-19T03:36:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c92b29a72c467c07799fd09dc9e0add45cf504a1",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-03-05T00:36:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b04481b24137029525f6dc372706fa9d3168f14",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-02-20T08:31:02Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f0b12677418f3cbb2aeffc2216bd36b0590dd418",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2025-01-22T03:57:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "0c4bc43d572ea9673468bf12cc30e8fb556550f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-12-11T04:56:37Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3ba28fd6a4037849dbdaf7f6341493b23db9e13c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-11-13T03:16:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ca7a694db4fff387bb6ca9775ddd3d3b5eba3d9c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-11-06T03:04:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e4d46be06c8d0d99f542e7199d1283850fb9192c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-10-10T05:50:45Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d48b4828c5f66dfb5171a71c47671e0d556dc2b4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-10-09T05:28:03Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e92ab7adaa3db1752639361ded41a7abb2d28996",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-08-07T06:30:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "db05d34dd0964dd241045cfc319c3a1bd45773e8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-07-03T05:25:26Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ca4b8ce34f4d4f4c1485da90a4247886c4e45335",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-06-19T06:08:58Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c587e0ce032898f6528ffc8374f1ebe3011b9158",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-06-05T05:16:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f671e05aca24ac73298ae4922b34607b634d59f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-05-22T08:18:50Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "05a2ae86f455231d1734f2442664b6891ec4d8dd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-05-08T05:24:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "863759766e2397d1f639c63d006680a9e8ba6233",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-04-10T07:29:34Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c011b5164178ac5224e658bf2aed713479fc78ae",
          "body": null,
          "is_bot": false,
          "headline": "Added version 7.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-03-20T05:46:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "01d1959b1200e0b872ea078e59ea5abfb5c54100",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2024-02-08T23:33:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b0073db409746748af4fc06fbee337bb99f462d9",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-12-11T03:21:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "15c7e5ccd1398486b773f2fc48dafc2d2ffaee8f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-29T09:44:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "56a705dcfe30211053cae2e21e5c7dc65fa7b083",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-22T11:14:25Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2a1344eb95eb8ed512f4ad56986bfc230c8c74c7",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-11-15T00:41:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a4c139bde17a4e8b2e84d225020cd5acc24a728a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-10-25T06:42:18Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b1ddb5ec9b0c7f5d542429a044bd303648d2d647",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-10-19T03:04:57Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "02e194ec4d37aab8335332f8ac3e8d2292ba2d47",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-30T11:10:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "4b795ce4049e2038c79d0ec940de78f17cbe4694",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-09T04:58:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6d4ca510724901084dde245481129b1cbea3aa74",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-08-02T05:17:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "575e3a4a602619a3d9e1cd0d437ce875ff756395",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-07-12T06:32:00Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3212d377b2132acc89c4887941e946fb61b33ee6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-06-19T04:36:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "31251ab0bdc693efb4d510a2d0edb07d47ca355c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-06-13T00:10:53Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6a37da4822eebcd2706793454b07bd891c5277a8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-04-26T10:48:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "b2327c03fba64f8c47ec030c1f3bce98da8f7596",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-03-29T01:33:40Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "488a05ddf56e844e593a3fb7da68aa5fb41f01ac",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-03-16T00:43:05Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6880668bef341a0572a8354768bb1f7f53f7121c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2023-02-22T07:52:19Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "bec6271ca90b2f37db48a955697746c1f58b9358",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-12-06T02:19:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "058c00937b0128720e3663d0bfcfe49d2926cf92",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-11-23T02:47:17Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "396dc0d4c4a970918e5a4322c7957c90c85c4c4f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-09-08T04:15:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "e6c8b0aa624deb507094918b5dd689d9fea28070",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-07-29T00:24:40Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "34ec83b058c32a19b62a15212995122c1ef79cdd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-07-27T03:47:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "c6cbe460317484cb45daec0dbabfe4c1d0bf6cc8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-06-29T05:36:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9563ee68e845cc256cc371a6c76a750a4bab7c15",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-05-25T04:10:33Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "6eb0c53e09bd552740dee0ede369f6b97d6983d5",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-04-27T03:41:08Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8898185c29290f52515bbd1ce53816181ce37c0f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-03-23T02:04:52Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "44ce3f31e18e9c70ec8210fe960fdb4941cd59f3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 6.0.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-03-03T04:28:36Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dadd7f25e31680f1c6bf61d2fb0b15794f425cd1",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2022-02-09T03:24:06Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "ef9962f1d40abbb80a4fd4f023151fd28f891a6c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-11-17T04:34:27Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "23dbb5d218707805b74c9fe4f1e2525bcd21e689",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-11-03T03:57:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dbd8fefb0bbe96ed15f9af4518b078ae2c20e020",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.10.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-10-11T03:18:15Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "48c665ad12ba0e4d8068ba0784026c7488aa4746",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-09-08T03:45:09Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "2692079b210682c63f12418ff613555efec218fd",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-08-27T04:39:18Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7a479e525582d09f315c2cf2a99075d6a798b535",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.9.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-08-26T05:43:13Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "dbf8c9ab481e11b660a957257c73f55e2af83b20",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-06-23T06:52:46Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7bbf6f5f7cfa927286523a7681fd20b8489f0709",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-05-20T02:06:43Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d2358148183b3887b9d7285b6207a8345da2adc6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.8.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-05-06T02:48:11Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "8273fb332de43e7929b7b78c13c72b32871f7394",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.7.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-03-17T01:43:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "729e1f713c3b6d526daa6cb8f7a3b3ad864c53e3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.7.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2021-02-10T03:44:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "310051defb85fec8581ace8b739ab7b18023db8a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-12-08T07:23:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "f78490be294c347958f310e547582856b8aa8101",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-11-25T03:13:16Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "933ded7b599708ed26b7524add7bbce21e777805",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.6.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-11-18T05:34:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a436d254bc8d62e50be1fdb3d3e98981ab0e4c40",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.5.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-10-01T05:31:22Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a2c91ba89b76a3cf1df632ab7f84a608f5ba52a0",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.5.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-09-29T04:32:21Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "71197b6a12405d7a6e2067f725c387595bd9b3f4",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-08-17T04:00:30Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "940fdcfa7aa2ade09a1ec916dadeee01baa7787a",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-07-08T04:08:07Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "aa17e50a1302fdb601a56e99b7b59f7abe5ff2a6",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.4.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-06-30T05:22:55Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "d61fb3a8f356c3e333e0108ac539c32aeadadfb3",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-06-10T04:52:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "680aa992f10f6ca37a700d5cfacf18beac86911b",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-05-27T04:42:29Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "5831401fd1681524b32992f6c485ef180ea84d2f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.3.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-05-21T03:33:49Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a9e4928aac63b18db3bc670661f8661133c3c205",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-04-23T02:47:51Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "29bd1c22d35ad8a27982fddbe11a84a124c24b40",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-03-25T02:45:35Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "3653eec90aba773ebd66183fb867c77af21b2c7c",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.2.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-02-13T04:02:12Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "1a55d7d048c62c64c3f43734dfaa4bc0d776a035",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.6 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2020-01-28T05:08:04Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "26d9f929904015cc5c269418e0b86c522a8f8846",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.5 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-19T06:21:48Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7fcdd149d2e2f6013c78a965b8fab2bbe011de4f",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.4 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-11T03:56:56Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "9332192a57fae1d717780486eabfd2d661e3b7e8",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.3 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-12-04T03:23:32Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "7587e9a7d09ea0a2ae16f6628918c1bd18df2baa",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.2 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-11-19T04:29:44Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "782aa3876f354b8d04fbf1124c4aa440cec9d199",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.1 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-10-28T06:39:23Z",
          "body_truncated": false,
          "is_coding_agent": false
        },
        {
          "oid": "a4eca7a227e4dd97ed4356f708f0f481ab5164cb",
          "body": null,
          "is_bot": false,
          "headline": "Added version 5.1.0 release.",
          "author_name": "ephox",
          "author_login": null,
          "committed_at": "2019-10-17T06:09:31Z",
          "body_truncated": false,
          "is_coding_agent": false
        }
      ],
      "releases_count": 100,
      "commits_last_year": 20,
      "latest_release_at": "2026-07-15T02:36:42Z",
      "latest_release_tag": "8.8.0",
      "releases_from_tags": true,
      "days_since_last_push": 6,
      "active_weeks_last_year": 16,
      "days_since_latest_release": 6,
      "mean_days_between_releases": 26.7
    },
    "community": {
      "has_readme": true,
      "has_license": true,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "tinymce",
          "exists": true,
          "license": "SEE LICENSE IN license.md",
          "keywords": [
            "wysiwyg",
            "tinymce",
            "richtext",
            "javascript",
            "html",
            "text",
            "rich editor",
            "rich text editor",
            "rte",
            "rich text",
            "contenteditable",
            "editing"
          ],
          "ecosystem": "npm",
          "matches_repo": false,
          "registry_url": "https://www.npmjs.com/package/tinymce",
          "is_deprecated": false,
          "latest_version": "8.8.0",
          "repository_url": "https://github.com/tinymce/tinymce",
          "versions_count": 218,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 3,
          "monthly_downloads": 4489241,
          "first_published_at": "2014-05-06T10:59:32.298000Z",
          "latest_published_at": "2026-07-15T02:38:50.723000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 6
        },
        {
          "name": "tinymce/tinymce",
          "exists": true,
          "license": "SEE LICENSE IN license.md",
          "keywords": [
            "text",
            "javascript",
            "wysiwyg",
            "tinymce",
            "html",
            "editing",
            "richtext",
            "contenteditable",
            "rte",
            "rich editor",
            "rich text editor",
            "rich text"
          ],
          "ecosystem": "packagist",
          "matches_repo": true,
          "registry_url": "https://packagist.org/packages/tinymce/tinymce",
          "is_deprecated": false,
          "latest_version": "8.8.0",
          "repository_url": "https://github.com/tinymce/tinymce-dist",
          "versions_count": 243,
          "total_downloads": 8167016,
          "dependents_count": 115,
          "deprecation_note": null,
          "maintainers_count": null,
          "monthly_downloads": 173352,
          "first_published_at": null,
          "latest_published_at": "2026-07-15T02:36:42Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 6
        }
      ]
    },
    "popularity": {
      "forks": 158,
      "stars": 170,
      "watchers": 24,
      "fork_history": {
        "days": [
          {
            "date": "2014-09-16",
            "count": 1
          },
          {
            "date": "2014-11-03",
            "count": 1
          },
          {
            "date": "2014-11-20",
            "count": 1
          },
          {
            "date": "2014-11-25",
            "count": 1
          },
          {
            "date": "2015-02-05",
            "count": 1
          },
          {
            "date": "2015-03-15",
            "count": 1
          },
          {
            "date": "2015-03-27",
            "count": 1
          },
          {
            "date": "2015-04-24",
            "count": 1
          },
          {
            "date": "2015-04-27",
            "count": 1
          },
          {
            "date": "2015-05-02",
            "count": 1
          },
          {
            "date": "2015-05-19",
            "count": 1
          },
          {
            "date": "2015-06-06",
            "count": 1
          },
          {
            "date": "2015-06-09",
            "count": 1
          },
          {
            "date": "2015-06-25",
            "count": 1
          },
          {
            "date": "2015-07-27",
            "count": 1
          },
          {
            "date": "2015-07-28",
            "count": 1
          },
          {
            "date": "2015-08-17",
            "count": 1
          },
          {
            "date": "2015-08-24",
            "count": 1
          },
          {
            "date": "2015-09-11",
            "count": 1
          },
          {
            "date": "2015-10-02",
            "count": 1
          },
          {
            "date": "2015-10-09",
            "count": 1
          },
          {
            "date": "2015-10-15",
            "count": 1
          },
          {
            "date": "2015-11-19",
            "count": 1
          },
          {
            "date": "2015-12-18",
            "count": 1
          },
          {
            "date": "2016-02-22",
            "count": 1
          },
          {
            "date": "2016-03-23",
            "count": 1
          },
          {
            "date": "2016-03-25",
            "count": 1
          },
          {
            "date": "2016-03-30",
            "count": 1
          },
          {
            "date": "2016-04-06",
            "count": 1
          },
          {
            "date": "2016-04-15",
            "count": 1
          },
          {
            "date": "2016-04-19",
            "count": 1
          },
          {
            "date": "2016-05-27",
            "count": 1
          },
          {
            "date": "2016-06-10",
            "count": 1
          },
          {
            "date": "2016-07-05",
            "count": 1
          },
          {
            "date": "2016-07-07",
            "count": 1
          },
          {
            "date": "2016-07-11",
            "count": 2
          },
          {
            "date": "2016-08-02",
            "count": 1
          },
          {
            "date": "2016-10-22",
            "count": 1
          },
          {
            "date": "2016-12-19",
            "count": 1
          },
          {
            "date": "2017-02-27",
            "count": 1
          },
          {
            "date": "2017-07-12",
            "count": 1
          },
          {
            "date": "2017-10-03",
            "count": 1
          },
          {
            "date": "2017-10-05",
            "count": 1
          },
          {
            "date": "2017-10-07",
            "count": 1
          },
          {
            "date": "2017-10-10",
            "count": 1
          },
          {
            "date": "2017-11-29",
            "count": 1
          },
          {
            "date": "2017-12-07",
            "count": 1
          },
          {
            "date": "2017-12-21",
            "count": 1
          },
          {
            "date": "2018-01-30",
            "count": 1
          },
          {
            "date": "2018-03-07",
            "count": 1
          },
          {
            "date": "2018-03-29",
            "count": 1
          },
          {
            "date": "2018-04-03",
            "count": 1
          },
          {
            "date": "2018-04-09",
            "count": 1
          },
          {
            "date": "2018-04-16",
            "count": 1
          },
          {
            "date": "2018-07-11",
            "count": 1
          },
          {
            "date": "2018-07-16",
            "count": 1
          },
          {
            "date": "2018-08-06",
            "count": 1
          },
          {
            "date": "2018-08-20",
            "count": 1
          },
          {
            "date": "2018-08-23",
            "count": 2
          },
          {
            "date": "2018-09-19",
            "count": 1
          },
          {
            "date": "2018-09-21",
            "count": 1
          },
          {
            "date": "2018-10-04",
            "count": 1
          },
          {
            "date": "2018-10-30",
            "count": 1
          },
          {
            "date": "2018-11-21",
            "count": 1
          },
          {
            "date": "2018-11-28",
            "count": 1
          },
          {
            "date": "2018-12-11",
            "count": 1
          },
          {
            "date": "2018-12-19",
            "count": 1
          },
          {
            "date": "2019-01-09",
            "count": 2
          },
          {
            "date": "2019-01-25",
            "count": 1
          },
          {
            "date": "2019-02-05",
            "count": 1
          },
          {
            "date": "2019-02-10",
            "count": 1
          },
          {
            "date": "2019-02-11",
            "count": 1
          },
          {
            "date": "2019-03-15",
            "count": 1
          },
          {
            "date": "2019-03-30",
            "count": 1
          },
          {
            "date": "2019-04-04",
            "count": 1
          },
          {
            "date": "2019-04-09",
            "count": 1
          },
          {
            "date": "2019-04-29",
            "count": 1
          },
          {
            "date": "2019-05-09",
            "count": 1
          },
          {
            "date": "2019-06-14",
            "count": 1
          },
          {
            "date": "2019-07-12",
            "count": 1
          },
          {
            "date": "2019-08-31",
            "count": 1
          },
          {
            "date": "2019-10-09",
            "count": 1
          },
          {
            "date": "2019-10-11",
            "count": 1
          },
          {
            "date": "2019-11-07",
            "count": 1
          },
          {
            "date": "2019-11-18",
            "count": 1
          },
          {
            "date": "2019-12-28",
            "count": 1
          },
          {
            "date": "2020-01-24",
            "count": 2
          },
          {
            "date": "2020-02-07",
            "count": 1
          },
          {
            "date": "2020-04-02",
            "count": 1
          },
          {
            "date": "2020-04-10",
            "count": 1
          },
          {
            "date": "2020-04-15",
            "count": 1
          },
          {
            "date": "2020-05-04",
            "count": 1
          },
          {
            "date": "2020-05-15",
            "count": 1
          },
          {
            "date": "2020-05-19",
            "count": 1
          },
          {
            "date": "2020-06-01",
            "count": 1
          },
          {
            "date": "2020-06-12",
            "count": 1
          },
          {
            "date": "2020-06-21",
            "count": 1
          },
          {
            "date": "2020-07-01",
            "count": 1
          },
          {
            "date": "2020-07-09",
            "count": 1
          },
          {
            "date": "2020-07-27",
            "count": 1
          },
          {
            "date": "2020-10-14",
            "count": 1
          },
          {
            "date": "2020-11-09",
            "count": 1
          },
          {
            "date": "2020-12-11",
            "count": 1
          },
          {
            "date": "2020-12-14",
            "count": 1
          },
          {
            "date": "2021-01-18",
            "count": 1
          },
          {
            "date": "2021-01-31",
            "count": 1
          },
          {
            "date": "2021-02-06",
            "count": 1
          },
          {
            "date": "2021-02-20",
            "count": 1
          },
          {
            "date": "2021-03-03",
            "count": 1
          },
          {
            "date": "2021-03-19",
            "count": 1
          },
          {
            "date": "2021-04-08",
            "count": 1
          },
          {
            "date": "2021-05-14",
            "count": 1
          },
          {
            "date": "2021-05-21",
            "count": 1
          },
          {
            "date": "2021-06-03",
            "count": 1
          },
          {
            "date": "2021-06-15",
            "count": 1
          },
          {
            "date": "2021-06-29",
            "count": 1
          },
          {
            "date": "2021-09-01",
            "count": 1
          },
          {
            "date": "2021-09-27",
            "count": 1
          },
          {
            "date": "2021-10-06",
            "count": 1
          },
          {
            "date": "2021-11-21",
            "count": 1
          },
          {
            "date": "2021-11-23",
            "count": 1
          },
          {
            "date": "2021-11-25",
            "count": 1
          },
          {
            "date": "2022-01-11",
            "count": 1
          },
          {
            "date": "2022-01-23",
            "count": 1
          },
          {
            "date": "2022-02-16",
            "count": 1
          },
          {
            "date": "2022-03-22",
            "count": 1
          },
          {
            "date": "2022-04-19",
            "count": 1
          },
          {
            "date": "2022-06-14",
            "count": 1
          },
          {
            "date": "2022-07-12",
            "count": 1
          },
          {
            "date": "2022-07-26",
            "count": 1
          },
          {
            "date": "2022-08-01",
            "count": 1
          },
          {
            "date": "2022-08-08",
            "count": 1
          },
          {
            "date": "2022-08-17",
            "count": 1
          },
          {
            "date": "2022-08-22",
            "count": 2
          },
          {
            "date": "2022-09-02",
            "count": 1
          },
          {
            "date": "2022-09-09",
            "count": 1
          },
          {
            "date": "2022-11-09",
            "count": 1
          },
          {
            "date": "2023-02-22",
            "count": 1
          },
          {
            "date": "2023-03-10",
            "count": 1
          },
          {
            "date": "2023-03-26",
            "count": 1
          },
          {
            "date": "2023-04-28",
            "count": 1
          },
          {
            "date": "2024-08-06",
            "count": 1
          },
          {
            "date": "2025-05-29",
            "count": 1
          },
          {
            "date": "2025-08-28",
            "count": 1
          },
          {
            "date": "2025-08-29",
            "count": 1
          },
          {
            "date": "2025-09-19",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 151,
        "total_forks": 158
      },
      "star_history": {
        "days": [
          {
            "date": "2014-05-08",
            "count": 1
          },
          {
            "date": "2014-05-15",
            "count": 1
          },
          {
            "date": "2014-05-16",
            "count": 1
          },
          {
            "date": "2014-05-19",
            "count": 1
          },
          {
            "date": "2014-05-31",
            "count": 1
          },
          {
            "date": "2014-06-25",
            "count": 1
          },
          {
            "date": "2014-07-23",
            "count": 1
          },
          {
            "date": "2014-08-15",
            "count": 1
          },
          {
            "date": "2014-08-18",
            "count": 1
          },
          {
            "date": "2014-10-20",
            "count": 1
          },
          {
            "date": "2014-10-27",
            "count": 1
          },
          {
            "date": "2014-11-04",
            "count": 1
          },
          {
            "date": "2014-11-21",
            "count": 1
          },
          {
            "date": "2014-12-29",
            "count": 1
          },
          {
            "date": "2015-01-20",
            "count": 1
          },
          {
            "date": "2015-02-19",
            "count": 1
          },
          {
            "date": "2015-03-17",
            "count": 1
          },
          {
            "date": "2015-06-10",
            "count": 1
          },
          {
            "date": "2015-06-29",
            "count": 1
          },
          {
            "date": "2015-07-08",
            "count": 1
          },
          {
            "date": "2015-07-28",
            "count": 1
          },
          {
            "date": "2015-08-07",
            "count": 1
          },
          {
            "date": "2015-12-01",
            "count": 1
          },
          {
            "date": "2015-12-11",
            "count": 2
          },
          {
            "date": "2016-01-04",
            "count": 1
          },
          {
            "date": "2016-01-07",
            "count": 1
          },
          {
            "date": "2016-01-13",
            "count": 1
          },
          {
            "date": "2016-02-24",
            "count": 1
          },
          {
            "date": "2016-04-21",
            "count": 2
          },
          {
            "date": "2016-05-18",
            "count": 1
          },
          {
            "date": "2016-09-05",
            "count": 1
          },
          {
            "date": "2016-10-25",
            "count": 1
          },
          {
            "date": "2017-01-10",
            "count": 1
          },
          {
            "date": "2017-01-11",
            "count": 1
          },
          {
            "date": "2017-02-14",
            "count": 1
          },
          {
            "date": "2017-02-21",
            "count": 1
          },
          {
            "date": "2017-03-05",
            "count": 1
          },
          {
            "date": "2017-03-30",
            "count": 1
          },
          {
            "date": "2017-05-09",
            "count": 1
          },
          {
            "date": "2017-06-25",
            "count": 1
          },
          {
            "date": "2017-09-10",
            "count": 1
          },
          {
            "date": "2017-12-21",
            "count": 1
          },
          {
            "date": "2017-12-27",
            "count": 1
          },
          {
            "date": "2018-01-03",
            "count": 1
          },
          {
            "date": "2018-01-14",
            "count": 1
          },
          {
            "date": "2018-02-20",
            "count": 1
          },
          {
            "date": "2018-03-20",
            "count": 1
          },
          {
            "date": "2018-03-26",
            "count": 1
          },
          {
            "date": "2018-04-11",
            "count": 1
          },
          {
            "date": "2018-05-17",
            "count": 1
          },
          {
            "date": "2018-06-08",
            "count": 2
          },
          {
            "date": "2018-06-15",
            "count": 1
          },
          {
            "date": "2018-06-29",
            "count": 1
          },
          {
            "date": "2018-07-31",
            "count": 2
          },
          {
            "date": "2018-08-12",
            "count": 1
          },
          {
            "date": "2018-09-01",
            "count": 1
          },
          {
            "date": "2018-09-07",
            "count": 1
          },
          {
            "date": "2018-09-27",
            "count": 1
          },
          {
            "date": "2018-11-03",
            "count": 1
          },
          {
            "date": "2019-01-09",
            "count": 1
          },
          {
            "date": "2019-02-18",
            "count": 1
          },
          {
            "date": "2019-02-28",
            "count": 1
          },
          {
            "date": "2019-03-08",
            "count": 1
          },
          {
            "date": "2019-03-15",
            "count": 1
          },
          {
            "date": "2019-04-07",
            "count": 1
          },
          {
            "date": "2019-04-14",
            "count": 1
          },
          {
            "date": "2019-04-18",
            "count": 1
          },
          {
            "date": "2019-05-30",
            "count": 1
          },
          {
            "date": "2019-05-31",
            "count": 1
          },
          {
            "date": "2019-06-12",
            "count": 1
          },
          {
            "date": "2019-06-14",
            "count": 1
          },
          {
            "date": "2019-08-01",
            "count": 1
          },
          {
            "date": "2019-08-29",
            "count": 1
          },
          {
            "date": "2019-09-04",
            "count": 1
          },
          {
            "date": "2019-09-17",
            "count": 1
          },
          {
            "date": "2019-10-11",
            "count": 1
          },
          {
            "date": "2019-10-15",
            "count": 1
          },
          {
            "date": "2019-11-01",
            "count": 1
          },
          {
            "date": "2019-11-02",
            "count": 1
          },
          {
            "date": "2019-12-09",
            "count": 1
          },
          {
            "date": "2020-01-04",
            "count": 1
          },
          {
            "date": "2020-01-17",
            "count": 1
          },
          {
            "date": "2020-01-19",
            "count": 1
          },
          {
            "date": "2020-01-23",
            "count": 1
          },
          {
            "date": "2020-01-24",
            "count": 1
          },
          {
            "date": "2020-03-16",
            "count": 1
          },
          {
            "date": "2020-04-01",
            "count": 2
          },
          {
            "date": "2020-04-02",
            "count": 1
          },
          {
            "date": "2020-04-23",
            "count": 1
          },
          {
            "date": "2020-05-14",
            "count": 1
          },
          {
            "date": "2020-05-22",
            "count": 2
          },
          {
            "date": "2020-06-16",
            "count": 1
          },
          {
            "date": "2020-07-26",
            "count": 1
          },
          {
            "date": "2020-09-22",
            "count": 1
          },
          {
            "date": "2020-10-05",
            "count": 1
          },
          {
            "date": "2020-11-09",
            "count": 1
          },
          {
            "date": "2020-11-21",
            "count": 1
          },
          {
            "date": "2020-12-23",
            "count": 1
          },
          {
            "date": "2021-01-11",
            "count": 1
          },
          {
            "date": "2021-01-31",
            "count": 1
          },
          {
            "date": "2021-02-02",
            "count": 1
          },
          {
            "date": "2021-02-05",
            "count": 1
          },
          {
            "date": "2021-03-06",
            "count": 1
          },
          {
            "date": "2021-03-17",
            "count": 1
          },
          {
            "date": "2021-04-08",
            "count": 1
          },
          {
            "date": "2021-04-21",
            "count": 1
          },
          {
            "date": "2021-04-22",
            "count": 1
          },
          {
            "date": "2021-05-06",
            "count": 1
          },
          {
            "date": "2021-07-12",
            "count": 1
          },
          {
            "date": "2021-07-13",
            "count": 1
          },
          {
            "date": "2021-07-14",
            "count": 1
          },
          {
            "date": "2021-07-17",
            "count": 1
          },
          {
            "date": "2021-07-21",
            "count": 1
          },
          {
            "date": "2021-07-27",
            "count": 1
          },
          {
            "date": "2021-08-16",
            "count": 1
          },
          {
            "date": "2021-08-17",
            "count": 1
          },
          {
            "date": "2021-09-24",
            "count": 1
          },
          {
            "date": "2021-10-05",
            "count": 1
          },
          {
            "date": "2021-11-21",
            "count": 1
          },
          {
            "date": "2021-11-23",
            "count": 1
          },
          {
            "date": "2021-12-13",
            "count": 1
          },
          {
            "date": "2022-01-29",
            "count": 1
          },
          {
            "date": "2022-03-03",
            "count": 1
          },
          {
            "date": "2022-03-20",
            "count": 1
          },
          {
            "date": "2022-04-21",
            "count": 1
          },
          {
            "date": "2022-05-28",
            "count": 1
          },
          {
            "date": "2022-06-07",
            "count": 1
          },
          {
            "date": "2022-07-01",
            "count": 1
          },
          {
            "date": "2022-07-04",
            "count": 1
          },
          {
            "date": "2022-09-01",
            "count": 1
          },
          {
            "date": "2022-09-28",
            "count": 1
          },
          {
            "date": "2022-12-04",
            "count": 1
          },
          {
            "date": "2023-02-22",
            "count": 1
          },
          {
            "date": "2023-02-25",
            "count": 1
          },
          {
            "date": "2023-04-21",
            "count": 1
          },
          {
            "date": "2023-05-02",
            "count": 1
          },
          {
            "date": "2023-05-27",
            "count": 1
          },
          {
            "date": "2023-05-31",
            "count": 1
          },
          {
            "date": "2023-06-26",
            "count": 1
          },
          {
            "date": "2023-08-13",
            "count": 1
          },
          {
            "date": "2023-09-08",
            "count": 1
          },
          {
            "date": "2023-10-16",
            "count": 1
          },
          {
            "date": "2023-10-23",
            "count": 1
          },
          {
            "date": "2023-12-09",
            "count": 1
          },
          {
            "date": "2024-02-25",
            "count": 1
          },
          {
            "date": "2024-03-25",
            "count": 1
          },
          {
            "date": "2024-04-11",
            "count": 1
          },
          {
            "date": "2024-07-07",
            "count": 1
          },
          {
            "date": "2024-10-25",
            "count": 1
          },
          {
            "date": "2024-10-29",
            "count": 1
          },
          {
            "date": "2024-12-27",
            "count": 1
          },
          {
            "date": "2025-02-24",
            "count": 1
          },
          {
            "date": "2025-02-28",
            "count": 1
          },
          {
            "date": "2025-06-09",
            "count": 1
          },
          {
            "date": "2025-07-03",
            "count": 1
          },
          {
            "date": "2025-08-29",
            "count": 1
          },
          {
            "date": "2025-10-20",
            "count": 1
          },
          {
            "date": "2025-12-17",
            "count": 1
          },
          {
            "date": "2026-01-12",
            "count": 1
          },
          {
            "date": "2026-01-15",
            "count": 1
          },
          {
            "date": "2026-02-06",
            "count": 1
          },
          {
            "date": "2026-02-21",
            "count": 1
          },
          {
            "date": "2026-06-19",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 169,
        "total_stars": 170
      },
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [],
      "toolchain_manifests": [],
      "largest_source_bytes": 1895997,
      "source_files_sampled": 221,
      "oversized_source_files": 22,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "composer.json",
        "package.json"
      ],
      "advisories": {
        "error": "No resolved dependencies to assess",
        "scope": "repository_graph",
        "source": null,
        "findings": [],
        "collected": false,
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm",
        "packagist"
      ],
      "dependencies": [],
      "all_dependencies": {
        "error": null,
        "source": "github-sbom",
        "packages": [],
        "collected": true,
        "truncated": false,
        "total_count": 0,
        "direct_count": 0,
        "indirect_count": 0
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 1,
        "merged_prs": 0,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 12
      },
      "bus_factor": 1,
      "bot_contributors": 0,
      "top_contributors": [
        {
          "type": "User",
          "login": "spocke",
          "commits": 74,
          "avatar_url": "https://avatars.githubusercontent.com/u/115879?v=4"
        },
        {
          "type": "User",
          "login": "jhaines",
          "commits": 1,
          "avatar_url": "https://avatars.githubusercontent.com/u/2252638?v=4"
        }
      ],
      "contributors_sampled": 2,
      "top_contributor_share": 0.987
    },
    "quality_signals": {
      "has_ci": false,
      "has_tests": false,
      "ci_workflows": [],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": null,
            "reason": "no pull request found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/30 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 10,
            "reason": "project has 3 contributing companies or organizations -- score normalized to 10",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": null,
            "reason": "no workflows found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 9,
            "reason": "license file detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 5,
            "reason": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": null,
            "reason": "no dependencies found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "no SAST tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": null,
            "reason": "No tokens found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 10,
            "reason": "0 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "23137d1b2f95cdd68f304292685157ba090e7518",
        "ran_at": "2026-07-21T20:25:32Z",
        "aggregate_score": 3.5,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/tinymce/tinymce-dist",
    "host": "github.com",
    "name": "tinymce-dist",
    "owner": "tinymce"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 48,
      "inputs": {
        "security": 35,
        "vitality": 74,
        "community": 61,
        "governance": 45,
        "engineering": 21
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "good",
        "name": "Vitality",
        "value": 74,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 64,
            "inputs": {
              "commits_last_year": 20,
              "human_commit_share": 1,
              "days_since_last_push": 6,
              "active_weeks_last_year": 16
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 6 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "16/52 weeks with commits",
                "points": 11.1,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 16
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "20 commits in the last year",
                "points": 11.9,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 20
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 5,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "excellent",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 88,
            "inputs": {
              "releases_count": 100,
              "latest_release_tag": "8.8.0",
              "releases_from_tags": true,
              "days_since_latest_release": 6,
              "mean_days_between_releases": 26.7
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "100 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 100
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 6 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "a release every ~26.7 days",
                "points": 27,
                "status": "met",
                "details": [
                  {
                    "code": "release_cadence",
                    "params": {
                      "gap": 26.7
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "maintained",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": null,
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": 6,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "last human commit 6 days ago",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_maintained",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "moderate",
        "name": "Community & Adoption",
        "value": 61,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "moderate",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 62,
            "inputs": {
              "forks": 158,
              "stars": 170,
              "watchers": 24,
              "growth_state": "organic",
              "growth_factor_pct": 100
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "170 stars",
                "points": 36.1,
                "status": "partial",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 170
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "158 forks",
                "points": 18.3,
                "status": "partial",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 158
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "24 watchers",
                "points": 7.6,
                "status": "partial",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 24
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "at_risk",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 44,
            "inputs": {
              "has_readme": true,
              "has_license": true,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file present, not a recognized license",
                "points": 16.9,
                "status": "partial",
                "details": [
                  {
                    "code": "license_custom",
                    "params": {}
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "good",
            "name": "Ecosystem adoption (downloads)",
            "note": null,
            "notes": [],
            "value": 84,
            "inputs": {
              "packages": [
                "tinymce/tinymce"
              ],
              "dependents": 115,
              "ecosystems": "packagist",
              "total_downloads": 8167016,
              "monthly_downloads": 173352
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "173,352 downloads/month across packagist",
                "points": 69.9,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 173352,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "115 packages depend on it",
                "points": 13.8,
                "status": "partial",
                "details": [
                  {
                    "code": "registry_dependents",
                    "params": {
                      "count": 115
                    }
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "at_risk",
        "name": "Sustainability & Governance",
        "value": 45,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 22,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 2,
              "top_contributor_share": 0.987
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 99% of commits",
                "points": 0.3,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 99
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "2 contributors",
                "points": 2.7,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 2
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 3 contributing companies or organizations -- score normalized to 10",
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "critical",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "merged_prs": 0,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 12
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "0/12 decided PRs merged",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 0,
                      "decided": 12
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/30 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "good",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 74,
            "inputs": {
              "followers": 418,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "tinymce",
              "public_repos": 102,
              "account_age_days": 6173
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "418 followers of tinymce",
                "points": 18.9,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 418,
                      "login": "tinymce"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "102 public repos, account ~16 yr old",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 102
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 16
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "tinymce/tinymce"
              ],
              "ecosystems": "packagist",
              "any_deprecated": false,
              "min_days_since_publish": 6
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on packagist",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "packagist"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 6 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 6
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "243 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 243
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "critical",
        "name": "Engineering Quality",
        "value": 21,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "critical",
            "name": "Engineering practices",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_ci_tests"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_ci": false,
              "has_tests": false,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [
                "tinymce"
              ],
              "has_wiki": false,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": "1 topics",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "topics_count",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "at_risk",
        "name": "Security",
        "value": 35,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "at_risk",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): CI-Tests, Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "ci_tests",
                    "dangerous_workflow",
                    "packaging",
                    "pinned_dependencies",
                    "signed_releases",
                    "token_permissions"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 35,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 12,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 6,
              "scorecard_aggregate": 3.5
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "no pull request found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/30 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 3 contributing companies or organizations -- score normalized to 10",
                "points": 2.5,
                "status": "met",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no workflows found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file detected",
                "points": 2.2,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "6 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 5",
                "points": 3.8,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "no SAST tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "No tokens found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "0 existing vulnerabilities detected",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 1
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "critical",
        "name": "AI Readiness",
        "value": 10,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": 0,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "0 of 100 human commits state their intent (structured subject or explanatory body)",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "legible_history",
                    "params": {
                      "legible": 0,
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "critical",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_pinned_dependencies"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_nix": false,
              "has_tests": false,
              "lockfiles": [],
              "has_dockerfile": false,
              "typed_language": false,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [],
              "agent_commit_share": 0,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": 0
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no agent-authored commits among the last 100",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_authored_commits",
                    "params": {
                      "sampled": 100
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no automated dependency updates observed",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_dependency_automation",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "moderate",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "primary_language": "JavaScript",
              "largest_source_bytes": 1895997,
              "source_files_sampled": 221,
              "oversized_source_files": 22
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "JavaScript without a type-check config",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_typecheck_config_language",
                    "params": {
                      "language": "JavaScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "22/221 source files over 60KB",
                "points": 49.5,
                "status": "partial",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 221,
                      "oversized": 22
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "npm package 'tinymce' points at a different repository (https://github.com/tinymce/tinymce); excluded from ecosystem scoring",
    "deps.dev does not index npm:tinymce@8.8.0; advisories assessed against the repository dependency graph instead"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-21T20:25:38.248671Z",
  "schema_version": "0.23.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/t/tinymce/tinymce-dist.svg",
  "full_name": "tinymce/tinymce-dist",
  "license_state": "custom",
  "license_spdx": null
}

Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.

Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.23.0 — повна методологія · вікі метрик.

Як окремий результат виглядає на тлі всього реєстру: сукупна статистикаnpm, Packagist.