Публічний реєстр
Звіт про здоров'я програмного забезпеченнясхема 0.18.0 · метрики 1.13.0 · 2026-07-21 13:10 UTC

AIsa-team / cli

CLI for the AISA unified AI infrastructure platform - access 70+ LLMs, web search, finance, Twitter, and video generation APIs

TypeScript · JavaScriptЛіцензію не виявлено★ 0 зірок⑂ 1 форкз бер. 2026 р.Переглянути на GitHub ↗

AIsa-team/cli має індекс здоров’я 40 зі 100, що відповідає смузі «У зоні ризику». Найвищий показник — Vitality (62/100), найнижчий — Security (15/100). Останнє оновлення було 4 дні тому. Більшість нещодавньої роботи виконує один учасник.

40
загалом / 100
У зоні ризику

Індекс здоров'я програмного забезпечення

Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.

40
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
ЖиттєздатністьСпільнота тавпровадженняСталість таврядуванняІнженернаякістьБезпекаГотовність доШІ

Профіль оцінок

Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.

Власність

AIsaОрганізація
11 підписників16 публічних репозиторіївз лист. 2025 р.

За цим репозиторієм стоїть організація — спільна, підзвітна опіка, здатна пережити будь-якого окремого мейнтейнера.

Пакетні екосистеми

РеєстрПакетВерсіяЗавантажень / місВерсіїОстання публікаціяТеги
npm@aisa-one/cli0.2.1531124 дні томуaisaaillmcliapigatewayskillsmcpopenai-compatibleai-agents

Метрики за категоріями

Життєздатність

Чи живий проєкт — чи пишеться код і чи виходять релізи?

62Помірний · 22% загального індексу
Як обчислюється оцінка
36/36Свіжість push — останній push 4 дн. тому
3.5/36Ритм комітів — 5/52 тижнів із комітами
13.5/18Обсяг комітів — 31 комітів за останній рік
3/10OpenSSF Scorecard: Maintained — 4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3
Використані вхідні дані
commits_last_year31
human_commit_share
days_since_last_push4
active_weeks_last_year5
Як обчислюється оцінка
16.2/27Випускає релізи — 1 тегів версій (без релізів GitHub)
36/36Свіжість релізів — останній реліз 4 дн. тому
12.6/27Ритм релізів — ритм невідомий (єдиний реліз)
0/10OpenSSF Scorecard: Signed-Releases — немає даних
Використані вхідні дані
releases_count1
latest_release_tagv0.2.1
releases_from_tagsтак
days_since_latest_release4
mean_days_between_releases
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: Signed-Releases. Залишкові ваги перенормовано.

Спільнота та впровадження

Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?

20Критичний · 18% загального індексу
Як обчислюється оцінка
0/60Зірки — 0 зірок
0/25Форки — 1 форків
0/15Спостерігачі — 0 спостерігачів
Використані вхідні дані
forks1
stars0
watchers0
growth_stateunverified
growth_factor_pct100
growth_unverified_reasonno_history
Як обчислюється оцінка
22.5/22.5README
0/22.5Ліцензія — файлу ліцензії не виявлено
0/18Настанови CONTRIBUTING
0/13.5Кодекс поведінки
0/7.2Шаблон issue
0/6.3Шаблон PR
Використані вхідні дані
has_readmeтак
has_licenseні
has_contributingні
has_issue_templateні
has_code_of_conductні
has_pull_request_templateні
Як обчислюється оцінка
36.3/80Щомісячні завантаження — 531 завантажень/місяць у npm
0/20Залежні пакети в реєстрі — ця екосистема цього не повідомляє
Використані вхідні дані
packages@aisa-one/cli
dependents
ecosystemsnpm
total_downloads
monthly_downloads531
Виключено з оцінювання (немає даних або не застосовно): Залежні пакети в реєстрі. Залишкові ваги перенормовано.

Сталість та врядування

Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?

58Помірний · 24% загального індексу
Як обчислюється оцінка
9/54Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів
9/22.5Розподіл комітів — головний контриб’ютор — автор 60% комітів
4.1/13.5Широта контриб’юторів — 3 контриб’юторів
3/10OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3
Використані вхідні дані
bus_factor1
contributors_sampled3
top_contributor_share0,6
Як обчислюється оцінка
0/46.8Вирішення issue — немає issue або даних
38.2/38.3Прийняття PR — злито 8/8 вирішених PR
0/15OpenSSF Scorecard: Code-Review — Found 0/22 approved changesets -- score normalized to 0
Використані вхідні дані
merged_prs8
open_issues0
closed_issues0
issue_closed_ratio
closed_unmerged_prs0
Виключено з оцінювання (немає даних або не застосовно): Вирішення issue. Залишкові ваги перенормовано.

Власність та опіка

48У зоні ризику
Як обчислюється оцінка
30/30Підтримка власника — у власності організації
0/20Верифікований домен
7.8/25Охоплення власника — 11 підписників у AIsa-team
10.3/25Послужний список — 16 публічних репозиторіїв, вік облікового запису ~0 р.
Використані вхідні дані
followers11
owner_typeOrganization
is_verified
owner_loginAIsa-team
public_repos16
account_age_days243

Супровід пакетів

100Відмінний
Як обчислюється оцінка
25/25Опубліковано й доступно — 1 пакет(ів) у npm
35/35Свіжість публікацій — остання публікація 4 дн. тому
20/20Історія версій — 12 опублікованих версій
20/20Не застарілий — активний, не deprecated і не yanked
Використані вхідні дані
packages@aisa-one/cli
ecosystemsnpm
any_deprecatedні
min_days_since_publish4

Інженерна якість

Чи наявні базові інженерні практики та документація?

34У зоні ризику · 20% загального індексу
Як обчислюється оцінка
0/24Процеси CI
24/24Наявні тести
0/16Конфігурація лінтера
0/9.6Pre-commit-хуки
0/6.4.editorconfig
0/20OpenSSF Scorecard: CI-Tests — 0 out of 8 merged PRs checked by a CI test -- score normalized to 0
Використані вхідні дані
has_ciні
has_testsтак
has_editorconfigні
has_linter_configні
has_precommit_configні

Документація

50Помірний
Як обчислюється оцінка
30/30README
0/25Каталог документації
0/15Сайт документації / домашня сторінка
10/10Опис репозиторію
0/10Теми
10/10Wiki
Використані вхідні дані
topics
has_wikiтак
homepage
has_readmeтак
has_docs_dirні
has_descriptionтак

Безпека

Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?

15Критичний · 16% загального індексу

Стан безпеки

15Критичний
Як обчислюється оцінка
7.5/7.5Binary-Artifacts — no binaries found in the repo
0/7.5Branch-Protection — branch protection not enabled on development/release branches
0/2.5CI-Tests — 0 out of 8 merged PRs checked by a CI test -- score normalized to 0
0/2.5CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected
0/7.5Code-Review — Found 0/22 approved changesets -- score normalized to 0
0.8/2.5Contributors — project has 1 contributing companies or organizations -- score normalized to 3
0/10Dangerous-Workflow — немає даних
0/7.5Dependency-Update-Tool — no update tool detected
0/5Fuzzing — project is not fuzzed
0/2.5Ліцензія — license file not detected
2.2/7.5Maintained — 4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3
0/5Packaging — немає даних
0/5Pinned-Dependencies — немає даних
0/5SAST — SAST tool is not run on all commits -- score normalized to 0
0/5Security-Policy — security policy file not detected
0/7.5Signed-Releases — немає даних
0/7.5Token-Permissions — немає даних
0/7.5Vulnerabilities — 12 existing vulnerabilities detected
Використані вхідні дані
sourceopenssf_scorecard
checks_evaluated13
scorecard_versionv5.5.0
checks_inconclusive5
scorecard_aggregate1,5
Виключено з оцінювання (немає даних або не застосовно): dangerous_workflow, packaging, pinned_dependencies, signed_releases, token_permissions. Залишкові ваги перенормовано.

Готовність до ШІ

Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.

46У зоні ризику · 0% загального індексу
Як обчислюється оцінка
0/45Інструкції для агентів — немає CLAUDE.md / AGENTS.md / правил редактора
0/15Машиночитана документація (llms.txt)
0/40Читабельна історія комітів — немає даних
Використані вхідні дані
has_llms_txtні
legible_history_share
agent_instruction_files
agent_instruction_max_bytes
Виключено з оцінювання (немає даних або не застосовно): Читабельна історія комітів. Залишкові ваги перенормовано.
Як обчислюється оцінка
0/18Розгортання однією командою
22/22Автоматизовані тести
0/11Конфігурація лінтера / форматера
11/11Статична перевірка типів — tsconfig.json
10/10Відтворюване середовище — lockfile
0/10Підтверджена практика роботи з агентами — немає даних
0/8Автоматизоване супроводження — немає даних
0/10OpenSSF Scorecard: Pinned-Dependencies — немає даних
Використані вхідні дані
has_nixні
has_testsтак
lockfilespackage-lock.json
has_dockerfileні
typed_languageтак
bootstrap_files
has_devcontainerні
has_linter_configні
typecheck_configstsconfig.json
agent_commit_share
toolchain_manifests
dependency_bot_commit_share
Виключено з оцінювання (немає даних або не застосовно): Підтверджена практика роботи з агентами, Автоматизоване супроводження, OpenSSF Scorecard: Pinned-Dependencies. Залишкові ваги перенормовано.
Як обчислюється оцінка
45/45Типізований код — TypeScript (статично типізована)
55/55Керовані розміри файлів — 0/23 файлів вихідного коду понад 60 КБ
Використані вхідні дані
primary_languageTypeScript
largest_source_bytes20 161
source_files_sampled23
oversized_source_files0

Ключові факти

0зірок GitHub
3контриб'юторів
31комітів за останні 12 місяців
4днів від останнього пушу
1релізів
1бас-фактор
0відкритих issue
npmпакетних екосистем

Попередження щодо збору даних

  • GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
  • deps.dev does not index npm:@aisa-one/cli@0.2.1; advisories assessed against the repository dependency graph instead

Докладніше

OpenSSF Scorecard 1.5 / 10
1.5сукупно

Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).Scorecard v5.5.0 · 2026-07-21 13:10 UTC

10Binary-Artifactsno binaries found in the repo
0Branch-Protectionbranch protection not enabled on development/release branches
0CI-Tests0 out of 8 merged PRs checked by a CI test -- score normalized to 0
0CII-Best-Practicesno effort to earn an OpenSSF best practices badge detected
0Code-ReviewFound 0/22 approved changesets -- score normalized to 0
3Contributorsproject has 1 contributing companies or organizations -- score normalized to 3
н/дDangerous-Workflowno workflows found
0Dependency-Update-Toolno update tool detected
0Fuzzingproject is not fuzzed
0Licenselicense file not detected
3Maintained4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3
н/дPackagingpackaging workflow not detected
н/дPinned-Dependenciesno dependencies found
0SASTSAST tool is not run on all commits -- score normalized to 0
0Security-Policysecurity policy file not detected
н/дSigned-Releasesno releases found
н/дToken-PermissionsNo tokens found
0Vulnerabilities12 existing vulnerabilities detected
Прямі залежності 4
РеєстрПакетОбмеження версіїМаніфест
npmchalk^5.3.0package.json
npmcommander^12.0.0package.json
npmconf^12.0.0package.json
npmora^8.0.1package.json
Усі залежності не зібрано

Не вдалося зібрати розв'язаний набір залежностей для цього звіту: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository

Звіт у форматі JSON машиночитний
{
  "data": {
    "repo": {
      "topics": [],
      "is_fork": false,
      "size_kb": 205,
      "has_wiki": true,
      "homepage": null,
      "languages": {
        "JavaScript": 17841,
        "TypeScript": 74718
      },
      "pushed_at": "2026-07-17T08:22:00Z",
      "created_at": "2026-03-03T08:44:11Z",
      "owner_type": "Organization",
      "updated_at": "2026-07-17T08:22:01Z",
      "description": "CLI for the AISA unified AI infrastructure platform - access 70+ LLMs, web search, finance, Twitter, and video generation APIs",
      "is_archived": false,
      "is_disabled": false,
      "license_spdx": null,
      "default_branch": "main",
      "license_spdx_raw": null,
      "primary_language": "TypeScript",
      "significant_languages": [
        "TypeScript",
        "JavaScript"
      ]
    },
    "owner": {
      "blog": "aisa.one",
      "name": "AIsa",
      "type": "Organization",
      "login": "AIsa-team",
      "company": null,
      "location": "United States of America",
      "followers": 11,
      "avatar_url": "https://avatars.githubusercontent.com/u/245091945?v=4",
      "created_at": "2025-11-20T02:42:18Z",
      "is_verified": null,
      "public_repos": 16,
      "account_age_days": 243
    },
    "license": {
      "state": "absent",
      "spdx_id": null,
      "raw_spdx": null,
      "file_present": false,
      "scorecard_found": false,
      "profile_has_license": false
    },
    "activity": {
      "releases_count": 1,
      "commits_last_year": 31,
      "latest_release_at": "2026-07-17T08:21:55Z",
      "latest_release_tag": "v0.2.1",
      "releases_from_tags": true,
      "days_since_last_push": 4,
      "active_weeks_last_year": 5,
      "days_since_latest_release": 4,
      "mean_days_between_releases": null
    },
    "community": {
      "has_readme": true,
      "has_license": false,
      "has_description": true,
      "has_contributing": false,
      "health_percentage": 37,
      "has_issue_template": false,
      "has_code_of_conduct": false,
      "has_pull_request_template": false
    },
    "ecosystem": {
      "packages": [
        {
          "name": "@aisa-one/cli",
          "exists": true,
          "license": "MIT",
          "keywords": [
            "aisa",
            "ai",
            "llm",
            "cli",
            "api",
            "gateway",
            "skills",
            "mcp",
            "openai-compatible",
            "ai-agents"
          ],
          "ecosystem": "npm",
          "matches_repo": true,
          "registry_url": "https://www.npmjs.com/package/@aisa-one/cli",
          "is_deprecated": false,
          "latest_version": "0.2.1",
          "repository_url": "https://github.com/AIsa-team/cli",
          "versions_count": 12,
          "total_downloads": null,
          "dependents_count": null,
          "deprecation_note": null,
          "maintainers_count": 3,
          "monthly_downloads": 531,
          "first_published_at": "2026-03-03T03:52:08.759000Z",
          "latest_published_at": "2026-07-17T09:04:16.825000Z",
          "latest_version_yanked": null,
          "days_since_latest_publish": 4
        }
      ]
    },
    "popularity": {
      "forks": 1,
      "stars": 0,
      "watchers": 0,
      "fork_history": {
        "days": [
          {
            "date": "2026-07-01",
            "count": 1
          }
        ],
        "complete": true,
        "collected": 1,
        "total_forks": 1
      },
      "star_history": {
        "days": [],
        "complete": true,
        "collected": 0,
        "total_stars": 0
      },
      "open_issues_and_prs": 1
    },
    "ai_readiness": {
      "has_nix": false,
      "example_dirs": [],
      "has_llms_txt": false,
      "has_dockerfile": false,
      "has_mcp_signal": false,
      "bootstrap_files": [],
      "api_schema_files": [],
      "has_devcontainer": false,
      "typecheck_configs": [
        "tsconfig.json"
      ],
      "largest_source_bytes": 20161,
      "source_files_sampled": 23,
      "oversized_source_files": 0,
      "agent_instruction_files": [],
      "agent_instruction_max_bytes": null
    },
    "dependencies": {
      "manifests": [
        "package.json"
      ],
      "advisories": {
        "error": null,
        "scope": null,
        "source": null,
        "findings": [],
        "collected": false,
        "truncated": false,
        "by_severity": {},
        "advisory_count": 0,
        "affected_count": 0,
        "assessed_count": 0,
        "assessed_package": null,
        "unassessed_count": 0,
        "direct_affected_count": 0
      },
      "ecosystems": [
        "npm"
      ],
      "dependencies": [
        {
          "name": "chalk",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^5.3.0"
        },
        {
          "name": "commander",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^12.0.0"
        },
        {
          "name": "conf",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^12.0.0"
        },
        {
          "name": "ora",
          "manifest": "package.json",
          "ecosystem": "npm",
          "version_constraint": "^8.0.1"
        }
      ],
      "all_dependencies": {
        "error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
        "source": null,
        "packages": [],
        "collected": false,
        "truncated": false,
        "total_count": null,
        "direct_count": null,
        "indirect_count": null
      }
    },
    "maintainership": {
      "issues": {
        "open_prs": 1,
        "merged_prs": 8,
        "open_issues": 0,
        "closed_ratio": null,
        "closed_issues": 0,
        "closed_unmerged_prs": 0
      },
      "bus_factor": 1,
      "top_contributors": [
        {
          "type": "User",
          "login": "renning22",
          "commits": 15,
          "avatar_url": "https://avatars.githubusercontent.com/u/4597657?v=4"
        },
        {
          "type": "User",
          "login": "karensheng",
          "commits": 6,
          "avatar_url": "https://avatars.githubusercontent.com/u/46656667?v=4"
        },
        {
          "type": "User",
          "login": "fatflowers",
          "commits": 4,
          "avatar_url": "https://avatars.githubusercontent.com/u/4362045?v=4"
        }
      ],
      "contributors_sampled": 3,
      "top_contributor_share": 0.6
    },
    "quality_signals": {
      "has_ci": false,
      "has_tests": true,
      "ci_workflows": [],
      "has_docs_dir": false,
      "linter_configs": [],
      "has_editorconfig": false,
      "has_linter_config": false,
      "has_precommit_config": false
    },
    "security_signals": {
      "lockfiles": [
        "package-lock.json"
      ],
      "scorecard": {
        "checks": [
          {
            "name": "Binary-Artifacts",
            "score": 10,
            "reason": "no binaries found in the repo",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
          },
          {
            "name": "Branch-Protection",
            "score": 0,
            "reason": "branch protection not enabled on development/release branches",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
          },
          {
            "name": "CI-Tests",
            "score": 0,
            "reason": "0 out of 8 merged PRs checked by a CI test -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
          },
          {
            "name": "CII-Best-Practices",
            "score": 0,
            "reason": "no effort to earn an OpenSSF best practices badge detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
          },
          {
            "name": "Code-Review",
            "score": 0,
            "reason": "Found 0/22 approved changesets -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
          },
          {
            "name": "Contributors",
            "score": 3,
            "reason": "project has 1 contributing companies or organizations -- score normalized to 3",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
          },
          {
            "name": "Dangerous-Workflow",
            "score": null,
            "reason": "no workflows found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
          },
          {
            "name": "Dependency-Update-Tool",
            "score": 0,
            "reason": "no update tool detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
          },
          {
            "name": "Fuzzing",
            "score": 0,
            "reason": "project is not fuzzed",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
          },
          {
            "name": "License",
            "score": 0,
            "reason": "license file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
          },
          {
            "name": "Maintained",
            "score": 3,
            "reason": "4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
          },
          {
            "name": "Packaging",
            "score": null,
            "reason": "packaging workflow not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
          },
          {
            "name": "Pinned-Dependencies",
            "score": null,
            "reason": "no dependencies found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
          },
          {
            "name": "SAST",
            "score": 0,
            "reason": "SAST tool is not run on all commits -- score normalized to 0",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
          },
          {
            "name": "Security-Policy",
            "score": 0,
            "reason": "security policy file not detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
          },
          {
            "name": "Signed-Releases",
            "score": null,
            "reason": "no releases found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
          },
          {
            "name": "Token-Permissions",
            "score": null,
            "reason": "No tokens found",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
          },
          {
            "name": "Vulnerabilities",
            "score": 0,
            "reason": "12 existing vulnerabilities detected",
            "documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
          }
        ],
        "commit": "6294165f86b6f46414614933dbc913dea1dcb2a3",
        "ran_at": "2026-07-21T13:10:41Z",
        "aggregate_score": 1.5,
        "scorecard_version": "v5.5.0"
      },
      "has_codeql_workflow": false,
      "has_security_policy": false,
      "has_dependabot_config": false
    }
  },
  "config": {
    "disabled_metrics": [],
    "disabled_categories": [],
    "disabled_components": {}
  },
  "source": {
    "url": "https://github.com/AIsa-team/cli",
    "host": "github.com",
    "name": "cli",
    "owner": "AIsa-team"
  },
  "metrics": {
    "overall": {
      "key": "overall",
      "band": "at_risk",
      "name": "Overall health",
      "note": null,
      "notes": [],
      "value": 40,
      "inputs": {
        "security": 15,
        "vitality": 62,
        "community": 20,
        "governance": 58,
        "engineering": 34
      },
      "components": []
    },
    "categories": [
      {
        "key": "vitality",
        "band": "moderate",
        "name": "Vitality",
        "value": 62,
        "weight": 0.22,
        "metrics": [
          {
            "key": "development_activity",
            "band": "moderate",
            "name": "Development activity",
            "note": null,
            "notes": [],
            "value": 56,
            "inputs": {
              "commits_last_year": 31,
              "human_commit_share": null,
              "days_since_last_push": 4,
              "active_weeks_last_year": 5
            },
            "components": [
              {
                "key": "push_recency",
                "name": "Push recency",
                "detail": "last push 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "push_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_cadence",
                "name": "Commit cadence",
                "detail": "5/52 weeks with commits",
                "points": 3.5,
                "status": "partial",
                "details": [
                  {
                    "code": "commit_cadence_weeks",
                    "params": {
                      "weeks": 5
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "commit_volume",
                "name": "Commit volume",
                "detail": "31 commits in the last year",
                "points": 13.5,
                "status": "partial",
                "details": [
                  {
                    "code": "commits_last_year",
                    "params": {
                      "count": 31
                    }
                  }
                ],
                "max_points": 18
              },
              {
                "key": "openssf_scorecard_maintained",
                "name": "OpenSSF Scorecard: Maintained",
                "detail": "4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3",
                "points": 3,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "release_discipline",
            "band": "good",
            "name": "Release discipline",
            "note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "openssf_scorecard_signed_releases"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 72,
            "inputs": {
              "releases_count": 1,
              "latest_release_tag": "v0.2.1",
              "releases_from_tags": true,
              "days_since_latest_release": 4,
              "mean_days_between_releases": null
            },
            "components": [
              {
                "key": "ships_releases",
                "name": "Ships releases",
                "detail": "1 version tags (no GitHub releases)",
                "points": 16.2,
                "status": "partial",
                "details": [
                  {
                    "code": "version_tags_no_releases",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 27
              },
              {
                "key": "release_recency",
                "name": "Release recency",
                "detail": "latest release 4 days ago",
                "points": 36,
                "status": "met",
                "details": [
                  {
                    "code": "release_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 36
              },
              {
                "key": "release_cadence",
                "name": "Release cadence",
                "detail": "cadence unknown (single release)",
                "points": 12.6,
                "status": "partial",
                "details": [
                  {
                    "code": "release_cadence_unknown",
                    "params": {}
                  }
                ],
                "max_points": 27
              },
              {
                "key": "openssf_scorecard_signed_releases",
                "name": "OpenSSF Scorecard: Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "abandonment",
            "band": "excellent",
            "name": "Abandonment",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "cap": null,
              "state": "unverified",
              "guards": [],
              "signals": [],
              "red_flag": false,
              "multiplier_pct": 100,
              "declared_reason": null,
              "unverified_reason": "repository_too_young",
              "unanswered_open_prs": null,
              "unanswered_open_issues": null,
              "days_since_last_merged_pr": null,
              "days_since_last_human_commit": null,
              "days_since_last_human_commit_is_floor": false
            },
            "components": [
              {
                "key": "project_is_still_maintained",
                "name": "Project is still maintained",
                "detail": "maintenance record not established from the collected data",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "abandonment_unverified",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Is the project alive — is code being written and are releases shipping?"
      },
      {
        "key": "community",
        "band": "critical",
        "name": "Community & Adoption",
        "value": 20,
        "weight": 0.18,
        "metrics": [
          {
            "key": "popularity",
            "band": "critical",
            "name": "Popularity & adoption",
            "note": null,
            "notes": [],
            "value": 1,
            "inputs": {
              "forks": 1,
              "stars": 0,
              "watchers": 0,
              "growth_state": "unverified",
              "growth_factor_pct": 100,
              "growth_unverified_reason": "no_history"
            },
            "components": [
              {
                "key": "stars",
                "name": "Stars",
                "detail": "0 stars",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "stars",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 60
              },
              {
                "key": "forks",
                "name": "Forks",
                "detail": "1 forks",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "forks",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "watchers",
                "name": "Watchers",
                "detail": "0 watchers",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "watchers",
                    "params": {
                      "count": 0
                    }
                  }
                ],
                "max_points": 15
              }
            ]
          },
          {
            "key": "community_health",
            "band": "critical",
            "name": "Community health",
            "note": null,
            "notes": [],
            "value": 25,
            "inputs": {
              "has_readme": true,
              "has_license": false,
              "has_contributing": false,
              "has_issue_template": false,
              "has_code_of_conduct": false,
              "has_pull_request_template": false
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 22.5,
                "status": "met",
                "details": [],
                "max_points": 22.5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "no license file detected",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "license_absent",
                    "params": {}
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributing_guide",
                "name": "CONTRIBUTING guide",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "code_of_conduct",
                "name": "Code of conduct",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 13.5
              },
              {
                "key": "issue_template",
                "name": "Issue template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.2
              },
              {
                "key": "pr_template",
                "name": "PR template",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.3
              }
            ]
          },
          {
            "key": "ecosystem_adoption",
            "band": "at_risk",
            "name": "Ecosystem adoption (downloads)",
            "note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "registry_dependents"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 45,
            "inputs": {
              "packages": [
                "@aisa-one/cli"
              ],
              "dependents": null,
              "ecosystems": "npm",
              "total_downloads": null,
              "monthly_downloads": 531
            },
            "components": [
              {
                "key": "monthly_downloads",
                "name": "Monthly downloads",
                "detail": "531 downloads/month across npm",
                "points": 36.3,
                "status": "partial",
                "details": [
                  {
                    "code": "downloads_monthly",
                    "params": {
                      "count": 531,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 80
              },
              {
                "key": "registry_dependents",
                "name": "Registry dependents",
                "detail": "not reported by this ecosystem",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "not_reported_by_this_ecosystem",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
      },
      {
        "key": "governance",
        "band": "moderate",
        "name": "Sustainability & Governance",
        "value": 58,
        "weight": 0.24,
        "metrics": [
          {
            "key": "maintainer_resilience",
            "band": "critical",
            "name": "Maintainer resilience (bus factor)",
            "note": null,
            "notes": [],
            "value": 25,
            "inputs": {
              "bus_factor": 1,
              "contributors_sampled": 3,
              "top_contributor_share": 0.6
            },
            "components": [
              {
                "key": "bus_factor",
                "name": "Bus factor",
                "detail": "1 contributor(s) cover half of all commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "bus_factor",
                    "params": {
                      "count": 1
                    }
                  }
                ],
                "max_points": 54
              },
              {
                "key": "commit_distribution",
                "name": "Commit distribution",
                "detail": "top contributor authored 60% of commits",
                "points": 9,
                "status": "partial",
                "details": [
                  {
                    "code": "top_contributor_share",
                    "params": {
                      "share": 60
                    }
                  }
                ],
                "max_points": 22.5
              },
              {
                "key": "contributor_breadth",
                "name": "Contributor breadth",
                "detail": "3 contributors",
                "points": 4.1,
                "status": "partial",
                "details": [
                  {
                    "code": "contributors_sampled",
                    "params": {
                      "count": 3
                    }
                  }
                ],
                "max_points": 13.5
              },
              {
                "key": "openssf_scorecard_contributors",
                "name": "OpenSSF Scorecard: Contributors",
                "detail": "project has 1 contributing companies or organizations -- score normalized to 3",
                "points": 3,
                "status": "partial",
                "details": [],
                "max_points": 10
              }
            ]
          },
          {
            "key": "responsiveness",
            "band": "good",
            "name": "Issue & PR responsiveness",
            "note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "issue_resolution"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 72,
            "inputs": {
              "merged_prs": 8,
              "open_issues": 0,
              "closed_issues": 0,
              "issue_closed_ratio": null,
              "closed_unmerged_prs": 0
            },
            "components": [
              {
                "key": "issue_resolution",
                "name": "Issue resolution",
                "detail": "no issues or no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_issues_or_data",
                    "params": {}
                  }
                ],
                "max_points": 46.75
              },
              {
                "key": "pr_acceptance",
                "name": "PR acceptance",
                "detail": "8/8 decided PRs merged",
                "points": 38.2,
                "status": "met",
                "details": [
                  {
                    "code": "decided_prs_merged",
                    "params": {
                      "merged": 8,
                      "decided": 8
                    }
                  }
                ],
                "max_points": 38.25
              },
              {
                "key": "openssf_scorecard_code_review",
                "name": "OpenSSF Scorecard: Code-Review",
                "detail": "Found 0/22 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              }
            ]
          },
          {
            "key": "stewardship",
            "band": "at_risk",
            "name": "Ownership & stewardship",
            "note": null,
            "notes": [],
            "value": 48,
            "inputs": {
              "followers": 11,
              "owner_type": "Organization",
              "is_verified": null,
              "owner_login": "AIsa-team",
              "public_repos": 16,
              "account_age_days": 243
            },
            "components": [
              {
                "key": "ownership_backing",
                "name": "Ownership backing",
                "detail": "organization-owned",
                "points": 30,
                "status": "met",
                "details": [
                  {
                    "code": "owner_organization",
                    "params": {}
                  }
                ],
                "max_points": 30
              },
              {
                "key": "verified_domain",
                "name": "Verified domain",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              },
              {
                "key": "owner_reach",
                "name": "Owner reach",
                "detail": "11 followers of AIsa-team",
                "points": 7.8,
                "status": "partial",
                "details": [
                  {
                    "code": "owner_followers",
                    "params": {
                      "count": 11,
                      "login": "AIsa-team"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "track_record",
                "name": "Track record",
                "detail": "16 public repos, account ~0 yr old",
                "points": 10.3,
                "status": "partial",
                "details": [
                  {
                    "code": "public_repos",
                    "params": {
                      "count": 16
                    }
                  },
                  {
                    "code": "account_age_years",
                    "params": {
                      "years": 0
                    }
                  }
                ],
                "max_points": 25
              }
            ]
          },
          {
            "key": "package_maintenance",
            "band": "excellent",
            "name": "Package maintenance",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "packages": [
                "@aisa-one/cli"
              ],
              "ecosystems": "npm",
              "any_deprecated": false,
              "min_days_since_publish": 4
            },
            "components": [
              {
                "key": "published_resolvable",
                "name": "Published & resolvable",
                "detail": "1 package(s) on npm",
                "points": 25,
                "status": "met",
                "details": [
                  {
                    "code": "packages_published",
                    "params": {
                      "count": 1,
                      "ecosystems": "npm"
                    }
                  }
                ],
                "max_points": 25
              },
              {
                "key": "publish_recency",
                "name": "Publish recency",
                "detail": "latest publish 4 days ago",
                "points": 35,
                "status": "met",
                "details": [
                  {
                    "code": "publish_recency",
                    "params": {
                      "days": 4
                    }
                  }
                ],
                "max_points": 35
              },
              {
                "key": "version_history",
                "name": "Version history",
                "detail": "12 published versions",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "published_versions",
                    "params": {
                      "count": 12
                    }
                  }
                ],
                "max_points": 20
              },
              {
                "key": "not_deprecated",
                "name": "Not deprecated",
                "detail": "active, not deprecated or yanked",
                "points": 20,
                "status": "met",
                "details": [
                  {
                    "code": "package_not_deprecated",
                    "params": {}
                  }
                ],
                "max_points": 20
              }
            ]
          }
        ],
        "description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
      },
      {
        "key": "engineering",
        "band": "at_risk",
        "name": "Engineering Quality",
        "value": 34,
        "weight": 0.2,
        "metrics": [
          {
            "key": "engineering_practices",
            "band": "critical",
            "name": "Engineering practices",
            "note": null,
            "notes": [],
            "value": 24,
            "inputs": {
              "has_ci": false,
              "has_tests": true,
              "has_editorconfig": false,
              "has_linter_config": false,
              "has_precommit_config": false
            },
            "components": [
              {
                "key": "ci_workflows",
                "name": "CI workflows",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 24
              },
              {
                "key": "tests_present",
                "name": "Tests present",
                "detail": null,
                "points": 24,
                "status": "met",
                "details": [],
                "max_points": 24
              },
              {
                "key": "linter_config",
                "name": "Linter config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 16
              },
              {
                "key": "pre_commit_hooks",
                "name": "Pre-commit hooks",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 9.6
              },
              {
                "key": "editorconfig",
                "name": ".editorconfig",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 6.4
              },
              {
                "key": "openssf_scorecard_ci_tests",
                "name": "OpenSSF Scorecard: CI-Tests",
                "detail": "0 out of 8 merged PRs checked by a CI test -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 20
              }
            ]
          },
          {
            "key": "documentation",
            "band": "moderate",
            "name": "Documentation",
            "note": null,
            "notes": [],
            "value": 50,
            "inputs": {
              "topics": [],
              "has_wiki": true,
              "homepage": null,
              "has_readme": true,
              "has_docs_dir": false,
              "has_description": true
            },
            "components": [
              {
                "key": "readme",
                "name": "README",
                "detail": null,
                "points": 30,
                "status": "met",
                "details": [],
                "max_points": 30
              },
              {
                "key": "documentation_directory",
                "name": "Documentation directory",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 25
              },
              {
                "key": "documentation_homepage_site",
                "name": "Documentation / homepage site",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "repository_description",
                "name": "Repository description",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              },
              {
                "key": "topics",
                "name": "Topics",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 10
              },
              {
                "key": "wiki",
                "name": "Wiki",
                "detail": null,
                "points": 10,
                "status": "met",
                "details": [],
                "max_points": 10
              }
            ]
          }
        ],
        "description": "Are baseline engineering and documentation practices in place?"
      },
      {
        "key": "security",
        "band": "critical",
        "name": "Security",
        "value": 15,
        "weight": 0.16,
        "metrics": [
          {
            "key": "security_posture",
            "band": "critical",
            "name": "Security posture",
            "note": "Excluded from scoring (no data or not applicable): Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "dangerous_workflow",
                    "packaging",
                    "pinned_dependencies",
                    "signed_releases",
                    "token_permissions"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 15,
            "inputs": {
              "source": "openssf_scorecard",
              "checks_evaluated": 13,
              "scorecard_version": "v5.5.0",
              "checks_inconclusive": 5,
              "scorecard_aggregate": 1.5
            },
            "components": [
              {
                "key": "binary_artifacts",
                "name": "Binary-Artifacts",
                "detail": "no binaries found in the repo",
                "points": 7.5,
                "status": "met",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "branch_protection",
                "name": "Branch-Protection",
                "detail": "branch protection not enabled on development/release branches",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "ci_tests",
                "name": "CI-Tests",
                "detail": "0 out of 8 merged PRs checked by a CI test -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "cii_best_practices",
                "name": "CII-Best-Practices",
                "detail": "no effort to earn an OpenSSF best practices badge detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "code_review",
                "name": "Code-Review",
                "detail": "Found 0/22 approved changesets -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "contributors",
                "name": "Contributors",
                "detail": "project has 1 contributing companies or organizations -- score normalized to 3",
                "points": 0.8,
                "status": "partial",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "dangerous_workflow",
                "name": "Dangerous-Workflow",
                "detail": "no workflows found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "dependency_update_tool",
                "name": "Dependency-Update-Tool",
                "detail": "no update tool detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "fuzzing",
                "name": "Fuzzing",
                "detail": "project is not fuzzed",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "license",
                "name": "License",
                "detail": "license file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 2.5
              },
              {
                "key": "maintained",
                "name": "Maintained",
                "detail": "4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3",
                "points": 2.2,
                "status": "partial",
                "details": [],
                "max_points": 7.5
              },
              {
                "key": "packaging",
                "name": "Packaging",
                "detail": "packaging workflow not detected",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "pinned_dependencies",
                "name": "Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 5
              },
              {
                "key": "sast",
                "name": "SAST",
                "detail": "SAST tool is not run on all commits -- score normalized to 0",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "security_policy",
                "name": "Security-Policy",
                "detail": "security policy file not detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 5
              },
              {
                "key": "signed_releases",
                "name": "Signed-Releases",
                "detail": "no releases found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "token_permissions",
                "name": "Token-Permissions",
                "detail": "No tokens found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 7.5
              },
              {
                "key": "vulnerabilities",
                "name": "Vulnerabilities",
                "detail": "12 existing vulnerabilities detected",
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 7.5
              }
            ]
          },
          {
            "key": "high_risk_jurisdiction_exposure",
            "band": "excellent",
            "name": "High-Risk Jurisdiction Exposure",
            "note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
            "notes": [
              {
                "code": "jurisdiction_evidence_limits",
                "params": {}
              }
            ],
            "value": 100,
            "inputs": {
              "meaning": "self-published location evidence; not nationality or citizenship",
              "red_flag": false,
              "exposures": [],
              "policy_countries": [
                "Russia",
                "Iran",
                "North Korea"
              ],
              "review_only_matches": 0,
              "assessed_self_published_locations": 4
            },
            "components": [
              {
                "key": "policy_exposure_multiplier",
                "name": "Policy exposure multiplier",
                "detail": "no confirmed policy-scope location match",
                "points": 100,
                "status": "met",
                "details": [
                  {
                    "code": "jurisdiction_no_match",
                    "params": {}
                  }
                ],
                "max_points": 100
              }
            ]
          }
        ],
        "description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
      },
      {
        "key": "ai_readiness",
        "band": "at_risk",
        "name": "AI Readiness",
        "value": 46,
        "weight": 0,
        "metrics": [
          {
            "key": "ai_agent_context",
            "band": "critical",
            "name": "Agent context & guidance",
            "note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "legible_commit_history"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 1,
            "inputs": {
              "has_llms_txt": false,
              "legible_history_share": null,
              "agent_instruction_files": [],
              "agent_instruction_max_bytes": null
            },
            "components": [
              {
                "key": "agent_instructions",
                "name": "Agent instructions",
                "detail": "no CLAUDE.md / AGENTS.md / editor rules",
                "points": 0,
                "status": "missed",
                "details": [
                  {
                    "code": "no_agent_instructions",
                    "params": {}
                  }
                ],
                "max_points": 45
              },
              {
                "key": "machine_readable_docs_llms_txt",
                "name": "Machine-readable docs (llms.txt)",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 15
              },
              {
                "key": "legible_commit_history",
                "name": "Legible commit history",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 40
              }
            ]
          },
          {
            "key": "ai_verify_loop",
            "band": "moderate",
            "name": "Verify loop (build / test / typecheck)",
            "note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance, OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
            "notes": [
              {
                "code": "excluded_no_data",
                "params": {
                  "components": [
                    "demonstrated_agent_practice",
                    "automated_maintenance",
                    "openssf_scorecard_pinned_dependencies"
                  ]
                }
              },
              {
                "code": "weights_renormalized",
                "params": {}
              }
            ],
            "value": 60,
            "inputs": {
              "has_nix": false,
              "has_tests": true,
              "lockfiles": [
                "package-lock.json"
              ],
              "has_dockerfile": false,
              "typed_language": true,
              "bootstrap_files": [],
              "has_devcontainer": false,
              "has_linter_config": false,
              "typecheck_configs": [
                "tsconfig.json"
              ],
              "agent_commit_share": null,
              "toolchain_manifests": [],
              "dependency_bot_commit_share": null
            },
            "components": [
              {
                "key": "one_command_bootstrap",
                "name": "One-command bootstrap",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 18
              },
              {
                "key": "automated_tests",
                "name": "Automated tests",
                "detail": null,
                "points": 22,
                "status": "met",
                "details": [],
                "max_points": 22
              },
              {
                "key": "lint_format_config",
                "name": "Lint / format config",
                "detail": null,
                "points": 0,
                "status": "missed",
                "details": [],
                "max_points": 11
              },
              {
                "key": "static_type_checking",
                "name": "Static type checking",
                "detail": "tsconfig.json",
                "points": 11,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "tsconfig.json"
                    }
                  }
                ],
                "max_points": 11
              },
              {
                "key": "reproducible_environment",
                "name": "Reproducible environment",
                "detail": "lockfile",
                "points": 10,
                "status": "met",
                "details": [
                  {
                    "code": "file_list",
                    "params": {
                      "files": "lockfile"
                    }
                  }
                ],
                "max_points": 10
              },
              {
                "key": "demonstrated_agent_practice",
                "name": "Demonstrated agent practice",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              },
              {
                "key": "automated_maintenance",
                "name": "Automated maintenance",
                "detail": "no data",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 8
              },
              {
                "key": "openssf_scorecard_pinned_dependencies",
                "name": "OpenSSF Scorecard: Pinned-Dependencies",
                "detail": "no dependencies found",
                "points": 0,
                "status": "excluded",
                "details": [
                  {
                    "code": "no_data",
                    "params": {}
                  }
                ],
                "max_points": 10
              }
            ]
          },
          {
            "key": "ai_code_legibility",
            "band": "excellent",
            "name": "Code legibility for models",
            "note": null,
            "notes": [],
            "value": 100,
            "inputs": {
              "primary_language": "TypeScript",
              "largest_source_bytes": 20161,
              "source_files_sampled": 23,
              "oversized_source_files": 0
            },
            "components": [
              {
                "key": "type_checkable_code",
                "name": "Type-checkable code",
                "detail": "TypeScript (statically typed)",
                "points": 45,
                "status": "met",
                "details": [
                  {
                    "code": "statically_typed_language",
                    "params": {
                      "language": "TypeScript"
                    }
                  }
                ],
                "max_points": 45
              },
              {
                "key": "manageable_file_sizes",
                "name": "Manageable file sizes",
                "detail": "0/23 source files over 60KB",
                "points": 55,
                "status": "met",
                "details": [
                  {
                    "code": "oversized_source_files",
                    "params": {
                      "kb": 60,
                      "sampled": 23,
                      "oversized": 0
                    }
                  }
                ],
                "max_points": 55
              }
            ]
          }
        ],
        "description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
      }
    ],
    "metrics_version": "1.13.0"
  },
  "warnings": [
    "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
    "deps.dev does not index npm:@aisa-one/cli@0.2.1; advisories assessed against the repository dependency graph instead"
  ],
  "report_type": "repository",
  "generated_at": "2026-07-21T13:10:53.410750Z",
  "schema_version": "0.18.0",
  "badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/a/AIsa-team/cli.svg",
  "full_name": "AIsa-team/cli",
  "license_state": "absent",
  "license_spdx": null
}

Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.

Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.18.0 — повна методологія · вікі метрик.

Як окремий результат виглядає на тлі всього реєстру: сукупна статистикаnpm.