CLI for the AISA unified AI infrastructure platform - access 70+ LLMs, web search, finance, Twitter, and video generation APIs
AIsa-team/cli tiene un índice de salud de 40 sobre 100, lo que lo sitúa en la banda En riesgo. Su puntuación más alta es Vitality (62/100) y la más baja, Security (15/100). Se actualizó por última vez hace 4 días. Una sola persona concentra la mayor parte del trabajo reciente.
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Este repositorio está respaldado por una organización: una custodia compartida y responsable que puede sobrevivir a cualquier mantenedor individual.
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| npm | @aisa-one/cli | 0.2.1 | 531 | 12 | hace 4 días | aisaaillmcliapigatewayskillsmcpopenai-compatibleai-agents |
¿Está vivo el proyecto: se escribe código y se publican versiones?
| 36/36 | Recencia de push — último push hace 4 días |
| 3.5/36 | Cadencia de commits — 5/52 semanas con commits |
| 13.5/18 | Volumen de commits — 31 commits en el último año |
| 3/10 | OpenSSF Scorecard: Maintained — 4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3 |
| commits_last_year | 31 |
| human_commit_share | — |
| days_since_last_push | 4 |
| active_weeks_last_year | 5 |
| 16.2/27 | Publica versiones — 1 etiquetas de versión (sin releases de GitHub) |
| 36/36 | Recencia de las versiones — última versión hace 4 días |
| 12.6/27 | Cadencia de publicación — cadencia desconocida (una sola versión) |
| 0/10 | OpenSSF Scorecard: Signed-Releases — sin datos |
| releases_count | 1 |
| latest_release_tag | v0.2.1 |
| releases_from_tags | sí |
| days_since_latest_release | 4 |
| mean_days_between_releases | — |
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
| 0/60 | Estrellas — 0 estrellas |
| 0/25 | Forks — 1 forks |
| 0/15 | Observadores — 0 observadores |
| forks | 1 |
| stars | 0 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 0/22.5 | Licencia — no se detectó ningún archivo de licencia |
| 0/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 0/6.3 | Plantilla de PR |
| has_readme | sí |
| has_license | no |
| has_contributing | no |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
| 36.3/80 | Descargas mensuales — 531 descargas/mes en npm |
| 0/20 | Dependientes en el registro — no lo informa este ecosistema |
| packages | @aisa-one/cli |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 531 |
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 9/22.5 | Distribución de commits — el principal contribuyente firma el 60% de los commits |
| 4.1/13.5 | Amplitud de contribuyentes — 3 contribuyentes |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| bus_factor | 1 |
| contributors_sampled | 3 |
| top_contributor_share | 0,6 |
| 0/46.8 | Resolución de issues — sin issues o sin datos |
| 38.2/38.3 | Aceptación de PR — 8/8 PR decididos fusionados |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/22 approved changesets -- score normalized to 0 |
| merged_prs | 8 |
| open_issues | 0 |
| closed_issues | 0 |
| issue_closed_ratio | — |
| closed_unmerged_prs | 0 |
| 30/30 | Respaldo de la propiedad — propiedad de una organización |
| 0/20 | Dominio verificado |
| 7.8/25 | Alcance del propietario — 11 seguidores de AIsa-team |
| 10.3/25 | Trayectoria — 16 repos públicos, cuenta de ~0 años |
| followers | 11 |
| owner_type | Organization |
| is_verified | — |
| owner_login | AIsa-team |
| public_repos | 16 |
| account_age_days | 243 |
| 25/25 | Publicado y resoluble — 1 paquete(s) en npm |
| 35/35 | Recencia de publicación — última publicación hace 4 días |
| 20/20 | Historial de versiones — 12 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
| packages | @aisa-one/cli |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 4 |
¿Existen unas prácticas mínimas de ingeniería y documentación?
| 0/24 | Flujos de trabajo de CI |
| 24/24 | Pruebas presentes |
| 0/16 | Configuración de linter |
| 0/9.6 | Hooks de pre-commit |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — 0 out of 8 merged PRs checked by a CI test -- score normalized to 0 |
| has_ci | no |
| has_tests | sí |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
| 30/30 | README |
| 0/25 | Directorio de documentación |
| 0/15 | Sitio de documentación / página del proyecto |
| 10/10 | Descripción del repositorio |
| 0/10 | Topics |
| 10/10 | Wiki |
| topics | — |
| has_wiki | sí |
| homepage | — |
| has_readme | sí |
| has_docs_dir | no |
| has_description | sí |
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
| 7.5/7.5 | Binary-Artifacts — no binaries found in the repo |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — 0 out of 8 merged PRs checked by a CI test -- score normalized to 0 |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/22 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 0/10 | Dangerous-Workflow — sin datos |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 0/2.5 | Licencia — license file not detected |
| 2.2/7.5 | Maintained — 4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3 |
| 0/5 | Packaging — sin datos |
| 0/5 | Pinned-Dependencies — sin datos |
| 0/5 | SAST — SAST tool is not run on all commits -- score normalized to 0 |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — sin datos |
| 0/7.5 | Token-Permissions — sin datos |
| 0/7.5 | Vulnerabilities — 12 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 13 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 5 |
| scorecard_aggregate | 1,5 |
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
| 0/45 | Instrucciones para agentes — sin CLAUDE.md / AGENTS.md / reglas de editor |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 0/40 | Historial de commits legible — sin datos |
| has_llms_txt | no |
| legible_history_share | — |
| agent_instruction_files | — |
| agent_instruction_max_bytes | — |
| 0/18 | Arranque con un solo comando |
| 22/22 | Pruebas automatizadas |
| 0/11 | Configuración de lint / formato |
| 11/11 | Verificación estática de tipos — tsconfig.json |
| 10/10 | Entorno reproducible — lockfile |
| 0/10 | Práctica demostrada con agentes — sin datos |
| 0/8 | Mantenimiento automatizado — sin datos |
| 0/10 | OpenSSF Scorecard: Pinned-Dependencies — sin datos |
| has_nix | no |
| has_tests | sí |
| lockfiles | package-lock.json |
| has_dockerfile | no |
| typed_language | sí |
| bootstrap_files | — |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | tsconfig.json |
| agent_commit_share | — |
| toolchain_manifests | — |
| dependency_bot_commit_share | — |
| 45/45 | Código verificable por tipos — TypeScript (tipado estático) |
| 55/55 | Tamaños de archivo manejables — 0/23 archivos fuente de más de 60 KB |
| primary_language | TypeScript |
| largest_source_bytes | 20.161 |
| source_files_sampled | 23 |
| oversized_source_files | 0 |
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 10 | Binary-Artifacts | no binaries found in the repo |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| 0 | CI-Tests | 0 out of 8 merged PRs checked by a CI test -- score normalized to 0 |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/22 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| n/d | Dangerous-Workflow | no workflows found |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 0 | License | license file not detected |
| 3 | Maintained | 4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3 |
| n/d | Packaging | packaging workflow not detected |
| n/d | Pinned-Dependencies | no dependencies found |
| 0 | SAST | SAST tool is not run on all commits -- score normalized to 0 |
| 0 | Security-Policy | security policy file not detected |
| n/d | Signed-Releases | no releases found |
| n/d | Token-Permissions | No tokens found |
| 0 | Vulnerabilities | 12 existing vulnerabilities detected |
| Registro | Paquete | Restricción de versión | Manifiesto |
|---|---|---|---|
| npm | chalk | ^5.3.0 | package.json |
| npm | commander | ^12.0.0 | package.json |
| npm | conf | ^12.0.0 | package.json |
| npm | ora | ^8.0.1 | package.json |
No fue posible recopilar el conjunto de dependencias resuelto para este informe: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
{
"data": {
"repo": {
"topics": [],
"is_fork": false,
"size_kb": 205,
"has_wiki": true,
"homepage": null,
"languages": {
"JavaScript": 17841,
"TypeScript": 74718
},
"pushed_at": "2026-07-17T08:22:00Z",
"created_at": "2026-03-03T08:44:11Z",
"owner_type": "Organization",
"updated_at": "2026-07-17T08:22:01Z",
"description": "CLI for the AISA unified AI infrastructure platform - access 70+ LLMs, web search, finance, Twitter, and video generation APIs",
"is_archived": false,
"is_disabled": false,
"license_spdx": null,
"default_branch": "main",
"license_spdx_raw": null,
"primary_language": "TypeScript",
"significant_languages": [
"TypeScript",
"JavaScript"
]
},
"owner": {
"blog": "aisa.one",
"name": "AIsa",
"type": "Organization",
"login": "AIsa-team",
"company": null,
"location": "United States of America",
"followers": 11,
"avatar_url": "https://avatars.githubusercontent.com/u/245091945?v=4",
"created_at": "2025-11-20T02:42:18Z",
"is_verified": null,
"public_repos": 16,
"account_age_days": 243
},
"license": {
"state": "absent",
"spdx_id": null,
"raw_spdx": null,
"file_present": false,
"scorecard_found": false,
"profile_has_license": false
},
"activity": {
"releases_count": 1,
"commits_last_year": 31,
"latest_release_at": "2026-07-17T08:21:55Z",
"latest_release_tag": "v0.2.1",
"releases_from_tags": true,
"days_since_last_push": 4,
"active_weeks_last_year": 5,
"days_since_latest_release": 4,
"mean_days_between_releases": null
},
"community": {
"has_readme": true,
"has_license": false,
"has_description": true,
"has_contributing": false,
"health_percentage": 37,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "@aisa-one/cli",
"exists": true,
"license": "MIT",
"keywords": [
"aisa",
"ai",
"llm",
"cli",
"api",
"gateway",
"skills",
"mcp",
"openai-compatible",
"ai-agents"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/@aisa-one/cli",
"is_deprecated": false,
"latest_version": "0.2.1",
"repository_url": "https://github.com/AIsa-team/cli",
"versions_count": 12,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 3,
"monthly_downloads": 531,
"first_published_at": "2026-03-03T03:52:08.759000Z",
"latest_published_at": "2026-07-17T09:04:16.825000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 4
}
]
},
"popularity": {
"forks": 1,
"stars": 0,
"watchers": 0,
"fork_history": {
"days": [
{
"date": "2026-07-01",
"count": 1
}
],
"complete": true,
"collected": 1,
"total_forks": 1
},
"star_history": {
"days": [],
"complete": true,
"collected": 0,
"total_stars": 0
},
"open_issues_and_prs": 1
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [],
"has_llms_txt": false,
"has_dockerfile": false,
"has_mcp_signal": false,
"bootstrap_files": [],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [
"tsconfig.json"
],
"largest_source_bytes": 20161,
"source_files_sampled": 23,
"oversized_source_files": 0,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"dependencies": {
"manifests": [
"package.json"
],
"advisories": {
"error": null,
"scope": null,
"source": null,
"findings": [],
"collected": false,
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"npm"
],
"dependencies": [
{
"name": "chalk",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^5.3.0"
},
{
"name": "commander",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^12.0.0"
},
{
"name": "conf",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^12.0.0"
},
{
"name": "ora",
"manifest": "package.json",
"ecosystem": "npm",
"version_constraint": "^8.0.1"
}
],
"all_dependencies": {
"error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"source": null,
"packages": [],
"collected": false,
"truncated": false,
"total_count": null,
"direct_count": null,
"indirect_count": null
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 8,
"open_issues": 0,
"closed_ratio": null,
"closed_issues": 0,
"closed_unmerged_prs": 0
},
"bus_factor": 1,
"top_contributors": [
{
"type": "User",
"login": "renning22",
"commits": 15,
"avatar_url": "https://avatars.githubusercontent.com/u/4597657?v=4"
},
{
"type": "User",
"login": "karensheng",
"commits": 6,
"avatar_url": "https://avatars.githubusercontent.com/u/46656667?v=4"
},
{
"type": "User",
"login": "fatflowers",
"commits": 4,
"avatar_url": "https://avatars.githubusercontent.com/u/4362045?v=4"
}
],
"contributors_sampled": 3,
"top_contributor_share": 0.6
},
"quality_signals": {
"has_ci": false,
"has_tests": true,
"ci_workflows": [],
"has_docs_dir": false,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 10,
"reason": "no binaries found in the repo",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": 0,
"reason": "0 out of 8 merged PRs checked by a CI test -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/22 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 3,
"reason": "project has 1 contributing companies or organizations -- score normalized to 3",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": null,
"reason": "no workflows found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 0,
"reason": "license file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 3,
"reason": "4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": null,
"reason": "no dependencies found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "SAST tool is not run on all commits -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": null,
"reason": "no releases found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": null,
"reason": "No tokens found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 0,
"reason": "12 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "6294165f86b6f46414614933dbc913dea1dcb2a3",
"ran_at": "2026-07-21T13:10:41Z",
"aggregate_score": 1.5,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/AIsa-team/cli",
"host": "github.com",
"name": "cli",
"owner": "AIsa-team"
},
"metrics": {
"overall": {
"key": "overall",
"band": "at_risk",
"name": "Overall health",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"security": 15,
"vitality": 62,
"community": 20,
"governance": 58,
"engineering": 34
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "moderate",
"name": "Vitality",
"value": 62,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "moderate",
"name": "Development activity",
"note": null,
"notes": [],
"value": 56,
"inputs": {
"commits_last_year": 31,
"human_commit_share": null,
"days_since_last_push": 4,
"active_weeks_last_year": 5
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "5/52 weeks with commits",
"points": 3.5,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 5
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "31 commits in the last year",
"points": 13.5,
"status": "partial",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 31
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3",
"points": 3,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "good",
"name": "Release discipline",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: Signed-Releases. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_signed_releases"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 72,
"inputs": {
"releases_count": 1,
"latest_release_tag": "v0.2.1",
"releases_from_tags": true,
"days_since_latest_release": 4,
"mean_days_between_releases": null
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "1 version tags (no GitHub releases)",
"points": 16.2,
"status": "partial",
"details": [
{
"code": "version_tags_no_releases",
"params": {
"count": 1
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 4 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 4
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "cadence unknown (single release)",
"points": 12.6,
"status": "partial",
"details": [
{
"code": "release_cadence_unknown",
"params": {}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "unverified",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": "repository_too_young",
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": null,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "maintenance record not established from the collected data",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_unverified",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "critical",
"name": "Community & Adoption",
"value": 20,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"forks": 1,
"stars": 0,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "0 stars",
"points": 0,
"status": "missed",
"details": [
{
"code": "stars",
"params": {
"count": 0
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "1 forks",
"points": 0,
"status": "missed",
"details": [
{
"code": "forks",
"params": {
"count": 1
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "critical",
"name": "Community health",
"note": null,
"notes": [],
"value": 25,
"inputs": {
"has_readme": true,
"has_license": false,
"has_contributing": false,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "no license file detected",
"points": 0,
"status": "missed",
"details": [
{
"code": "license_absent",
"params": {}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "at_risk",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"packages": [
"@aisa-one/cli"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 531
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "531 downloads/month across npm",
"points": 36.3,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 531,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "moderate",
"name": "Sustainability & Governance",
"value": 58,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 25,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 3,
"top_contributor_share": 0.6
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 60% of commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 60
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "3 contributors",
"points": 4.1,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 3
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 3,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "good",
"name": "Issue & PR responsiveness",
"note": "Excluded from scoring (no data or not applicable): Issue resolution. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"issue_resolution"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 72,
"inputs": {
"merged_prs": 8,
"open_issues": 0,
"closed_issues": 0,
"issue_closed_ratio": null,
"closed_unmerged_prs": 0
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "no issues or no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_issues_or_data",
"params": {}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "8/8 decided PRs merged",
"points": 38.2,
"status": "met",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 8,
"decided": 8
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/22 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "at_risk",
"name": "Ownership & stewardship",
"note": null,
"notes": [],
"value": 48,
"inputs": {
"followers": 11,
"owner_type": "Organization",
"is_verified": null,
"owner_login": "AIsa-team",
"public_repos": 16,
"account_age_days": 243
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "organization-owned",
"points": 30,
"status": "met",
"details": [
{
"code": "owner_organization",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "11 followers of AIsa-team",
"points": 7.8,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 11,
"login": "AIsa-team"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "16 public repos, account ~0 yr old",
"points": 10.3,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 16
}
},
{
"code": "account_age_years",
"params": {
"years": 0
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"packages": [
"@aisa-one/cli"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 4
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 4 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 4
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "12 published versions",
"points": 20,
"status": "met",
"details": [
{
"code": "published_versions",
"params": {
"count": 12
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "at_risk",
"name": "Engineering Quality",
"value": 34,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "critical",
"name": "Engineering practices",
"note": null,
"notes": [],
"value": 24,
"inputs": {
"has_ci": false,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "0 out of 8 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "moderate",
"name": "Documentation",
"note": null,
"notes": [],
"value": 50,
"inputs": {
"topics": [],
"has_wiki": true,
"homepage": null,
"has_readme": true,
"has_docs_dir": false,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "critical",
"name": "Security",
"value": 15,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "critical",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): Dangerous-Workflow, Packaging, Pinned-Dependencies, Signed-Releases, Token-Permissions. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"dangerous_workflow",
"packaging",
"pinned_dependencies",
"signed_releases",
"token_permissions"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 15,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 13,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 5,
"scorecard_aggregate": 1.5
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "no binaries found in the repo",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "0 out of 8 merged PRs checked by a CI test -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/22 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 0.8,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no workflows found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "4 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 3",
"points": 2.2,
"status": "partial",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "SAST tool is not run on all commits -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "no releases found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "No tokens found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "12 existing vulnerabilities detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 4
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "at_risk",
"name": "AI Readiness",
"value": 46,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "critical",
"name": "Agent context & guidance",
"note": "Excluded from scoring (no data or not applicable): Legible commit history. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"legible_commit_history"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 1,
"inputs": {
"has_llms_txt": false,
"legible_history_share": null,
"agent_instruction_files": [],
"agent_instruction_max_bytes": null
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": "no CLAUDE.md / AGENTS.md / editor rules",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_agent_instructions",
"params": {}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "moderate",
"name": "Verify loop (build / test / typecheck)",
"note": "Excluded from scoring (no data or not applicable): Demonstrated agent practice, Automated maintenance, OpenSSF Scorecard: Pinned-Dependencies. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"demonstrated_agent_practice",
"automated_maintenance",
"openssf_scorecard_pinned_dependencies"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"package-lock.json"
],
"has_dockerfile": false,
"typed_language": true,
"bootstrap_files": [],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"tsconfig.json"
],
"agent_commit_share": null,
"toolchain_manifests": [],
"dependency_bot_commit_share": null
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "tsconfig.json",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "tsconfig.json"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no data",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "no dependencies found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "excellent",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"primary_language": "TypeScript",
"largest_source_bytes": 20161,
"source_files_sampled": 23,
"oversized_source_files": 0
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "TypeScript (statically typed)",
"points": 45,
"status": "met",
"details": [
{
"code": "statically_typed_language",
"params": {
"language": "TypeScript"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "0/23 source files over 60KB",
"points": 55,
"status": "met",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 23,
"oversized": 0
}
}
],
"max_points": 55
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"deps.dev does not index npm:@aisa-one/cli@0.2.1; advisories assessed against the repository dependency graph instead"
],
"report_type": "repository",
"generated_at": "2026-07-21T13:10:53.410750Z",
"schema_version": "0.18.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/a/AIsa-team/cli.svg",
"full_name": "AIsa-team/cli",
"license_state": "absent",
"license_spdx": null
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.18.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — npm.