Llama cpp + CapacitorJS support
arusatech/llama-cpp-pro holds a health index of 53 out of 100, placing it in the Moderate band. It scores highest on Engineering Quality (84/100) and lowest on Security (23/100). It was last updated 49 days ago. A single contributor accounts for most of its recent work.
Metrics are grouped into weighted categories on one standardized 1–100 scale. Overall starts as their weighted mean, calibrated against the distribution of the public record so bands carry percentile meaning; when public evidence triggers the High-Risk Jurisdiction Policy, the rating is adjusted and receives an At Risk ceiling of 34.
Each axis is a category. The shape matters more than the average — a healthy subject fills the whole shape, while a spike-and-crater profile means strength in one dimension is masking risk in another.
The weighted overall 52 is calibrated to 53 on the published index scale (record calibration 2026-08-02).
This repository is owned by a personal account. A single-owner project carries more continuity risk than an organization-backed one.
| Registry | Package | Version | Downloads / mo | Versions | Last publish | Tags |
|---|---|---|---|---|---|---|
| npm | llama-cpp-pro | 0.2.4 | 434 | 3 | 54 days ago | llamallama-cppllama.cppggufllmcapacitorcapacitor-pluginoffline-ailocal-llmiosandroidelectronpwabindingsaicmakecmake-jsprebuilt-binariesmetalcudavulkangrammarembeddingembeddingsrerankrerankingjson-grammarjson-schema-grammarfunctionsfunction-callingtoken-predictionspeculative-decodingtemperatureminptopktoppseedxtcjson-schemaraspberry-piself-hostedlocalcataimistraldeepseekqwenqwqgptgpt-osstypescriptlorabatchinggpumultimodalchat-completionionicannadata |
| crates.io | llama_enginepoints to another repo — not scored | 0.1.1 | 40 | 2 | 210 days ago | — |
Is the project alive — is code being written and are releases shipping?
| 18/36 | Push recency — last push 49 days ago |
| 7.6/36 | Commit cadence — 11/52 weeks with commits |
| 17.7/18 | Commit volume — 92 commits in the last year |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| commits_last_year | 92 |
| human_commit_share | 1 |
| days_since_last_push | 49 |
| active_weeks_last_year | 11 |
| 27/27 | Ships releases — 2 releases published |
| 36/36 | Release recency — latest release 69 days ago |
| 27/27 | Release cadence — a release every ~2.8 days |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
| releases_count | 2 |
| latest_release_tag | v0.2.2 |
| releases_from_tags | no |
| days_since_latest_release | 69 |
| mean_days_between_releases | 2.8 |
Does the project have users, downloads, attention, and a welcoming setup for contributors?
| 12.6/60 | Stars — 7 stars |
| 5/25 | Forks — 5 forks |
| 0/15 | Watchers — 0 watchers |
| forks | 5 |
| stars | 7 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
| 22.5/22.5 | README |
| 22.5/22.5 | License — recognized license (MIT) |
| 18/18 | CONTRIBUTING guide |
| 0/13.5 | Code of conduct |
| 0/7.2 | Issue template |
| 0/6.3 | PR template |
| has_readme | yes |
| has_license | yes |
| readme_badges | 5 |
| has_contributing | yes |
| has_issue_template | no |
| has_code_of_conduct | no |
| readme_badge_services | github.com, shields.io |
| has_pull_request_template | no |
| 35.2/80 | Monthly downloads — 434 downloads/month across npm |
| 0/20 | Registry dependents — not reported by this ecosystem |
| packages | llama-cpp-pro |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 434 |
| unverified_packages_excluded | — |
Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?
| 9/54 | Bus factor — 1 contributor(s) cover half of all commits |
| 0/22.5 | Commit distribution — top contributor authored 100% of commits |
| 1.4/13.5 | Contributor breadth — 1 contributors |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
| 0/42 | Issue resolution — 0% of issues closed |
| 0/30 | PR acceptance — 0/1 decided PRs merged |
| 0/13 | Newcomer PR acceptance — no first-time contributor's PR decided in 30d |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| merged_prs | 0 |
| open_issues | 1 |
| closed_issues | 0 |
| prs_merged_7d | 0 |
| prs_decided_7d | 0 |
| prs_merged_30d | 0 |
| prs_decided_30d | 0 |
| issue_closed_ratio | 0 |
| closed_unmerged_prs | 1 |
| first_time_authors_30d | 0 |
| first_time_prs_merged_30d | 0 |
| first_time_prs_decided_30d | 0 |
| 10/30 | Ownership backing — personal (user) account |
| 0/20 | Verified domain — not applicable to user accounts |
| 4.3/25 | Owner reach — 3 followers of arusatech |
| 17/25 | Track record — 19 public repos, account ~3 yr old |
| followers | 3 |
| owner_type | User |
| is_verified | — |
| owner_login | arusatech |
| public_repos | 19 |
| account_age_days | 1,383 |
| 25/25 | Published & resolvable — 1 package(s) on npm |
| 35/35 | Publish recency — latest publish 54 days ago |
| 12/20 | Version history — 3 published versions |
| 20/20 | Not deprecated — active, not deprecated or yanked |
| packages | llama-cpp-pro |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 54 |
Are baseline engineering and documentation practices in place?
| 24/24 | CI workflows — 1 workflow(s) |
| 24/24 | Tests present |
| 16/16 | Linter config — package.json ("eslintConfig", "prettier") |
| 0/9.6 | Pre-commit hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — no data |
| has_ci | yes |
| has_tests | yes |
| has_editorconfig | no |
| has_linter_config | yes |
| has_precommit_config | no |
| 30/30 | README |
| 25/25 | Documentation directory |
| 15/15 | Documentation / homepage site — https://annadata.ai |
| 10/10 | Repository description |
| 0/10 | Topics |
| 10/10 | Wiki |
| topics | — |
| has_wiki | yes |
| homepage | — |
| docs_site | https://annadata.ai |
| has_readme | yes |
| has_docs_dir | yes |
| has_description | yes |
Are visible security and supply-chain practices strong, without unresolved high-risk jurisdiction exposure?
| 0/7.5 | Binary-Artifacts — binaries present in source code |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — no data |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | License — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — no data |
| 2/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 0/7.5 | Vulnerabilities — 10 existing vulnerabilities detected |
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 2.3 |
How well is the repo equipped to be developed and maintained with AI coding agents? Carries a deliberately small weight (4%): agent tooling is a real maintenance signal, but a repository with none can still reach 100/100.
| 45/45 | Agent instructions — .cursor/rules/annadata-app-client.mdc |
| 0/15 | Machine-readable docs (llms.txt) |
| 3.7/40 | Legible commit history — 7 of 100 human commits state their intent (structured subject or explanatory body) |
| has_llms_txt | no |
| llms_txt_url | — |
| legible_history_share | 0.07 |
| agent_instruction_files | .cursor/rules/annadata-app-client.mdc |
| agent_instruction_max_bytes | 1,323 |
| 18/18 | One-command bootstrap — ios/build-device/Makefile, ios/build-simulator/Makefile |
| 22/22 | Automated tests |
| 11/11 | Lint / format config — package.json ("eslintConfig", "prettier") |
| 11/11 | Static type checking — tsconfig.json |
| 10/10 | Reproducible environment — Dockerfile, lockfile |
| 10/10 | Demonstrated agent practice — 7 of the last 100 commits agent-authored or agent-credited |
| 0/8 | Automated maintenance — no automated dependency updates observed |
| 4/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
| has_nix | no |
| has_tests | yes |
| lockfiles | Cargo.lock, package-lock.json |
| has_dockerfile | yes |
| typed_language | no |
| bootstrap_files | ios/build-device/Makefile, ios/build-simulator/Makefile |
| has_devcontainer | no |
| has_linter_config | yes |
| typecheck_configs | tsconfig.json |
| agent_commit_share | 0.07 |
| toolchain_manifests | .release-stage/package/android/build.gradle, android/build.gradle, src-rust/Cargo.toml |
| dependency_bot_commit_share | 0 |
| 27/45 | Type-checkable code — Makefile with type-check config (tsconfig.json) |
| 48.1/55 | Manageable file sizes — 40/319 source files over 60KB |
| primary_language | Makefile |
| largest_source_bytes | 4,025,780 |
| source_files_sampled | 319 |
| oversized_source_files | 40 |
| 0/40 | API schema (OpenAPI/GraphQL/proto) — not applicable to this kind of software |
| 0/20 | MCP server — not applicable to this kind of software |
| 40/40 | Runnable examples — examples |
| example_dirs | examples |
| has_mcp_signal | no |
| api_schema_files | — |
| interfaces_expected_of | — |
When each star and fork was added, collected from GitHub and bucketed by day. Cumulative growth sits directly above the daily additions it is made of, so the two read against each other: steady organic accretion looks nothing like an abrupt, short-lived burst. Where that difference is measurable, it is reported as growth authenticity.
Independent, tool-agnostic security assessment from the open-source OpenSSF Scorecard. Each check rewards a security practice, not a specific vendor's tool. Checks Scorecard could not determine are marked n/a and excluded from the security score (never counted as zero).
| 0 | Binary-Artifacts | binaries present in source code |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/a | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| n/a | Packaging | packaging workflow not detected |
| 4 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 4 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 0 | Vulnerabilities | 10 existing vulnerabilities detected |
| Registry | Package | Version constraint | Manifest |
|---|---|---|---|
| crates.io | wasm-bindgen | 0.2 | src-rust/Cargo.toml |
| crates.io | serde | 1 | src-rust/Cargo.toml |
| crates.io | serde_json | 1 | src-rust/Cargo.toml |
| crates.io | js-sys | 0.3 | src-rust/Cargo.toml |
| crates.io | web-sys | 0.3 | src-rust/Cargo.toml |
The resolved dependency set could not be collected for this report: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Spotted something off in this report, or have thoughts to share? Wrong measurements, missed tooling, ideas, questions — anything is welcome. Every message is read and gets a response.
Scores are signals, not warranties. They reflect publicly visible practices on GitHub — not a code audit, and not a security guarantee.
Missing data is excluded and weights renormalized, never scored as zero. Methodology is versioned and open: metrics v2.10.0, schema v0.34.0 — full methodology · metrics wiki.
How one result sits in the wider record: aggregate statistics — npm, crates.io.