Публічний реєстрПомірний
Звіт про здоров'я програмного забезпеченнясхема 0.27.0 · метрики 1.13.0 · 2026-07-31 14:04 UTC
arusatech / llama-cpp-pro
Llama cpp + CapacitorJS support
arusatech/llama-cpp-pro має індекс здоров’я 51 зі 100, що відповідає смузі «Помірний». Найвищий показник — Vitality (80/100), найнижчий — Security (28/100). Останнє оновлення було 3 дні тому. Більшість нещодавньої роботи виконує один учасник.
51
загалом / 100Індекс здоров'я програмного забезпечення
Метрики згруповано у зважені категорії на шкалі 1–100. Загальна оцінка починається як їхнє середнє; коли публічні дані активують Політику юрисдикцій високого ризику, рейтинг коригується й отримує верхню межу 49 («Під ризиком»). Готовність до ШІ не входить до індексу.
51
Відмінний85-100Зразковий; відповідає практично всім перевіреним критеріям
Добрий70-84Здоровий; незначні прогалини
Помірний50-69Прийнятний, але з помітними прогалинами; рекомендовано перевірку
У зоні ризику30-49Суттєві слабкі місця; впровадження потребує обережності
Критичний1-29Серйозні проблеми (покинутий, єдиний мейнтейнер, без базової гігієни)
Профіль оцінок
Кожна вісь — окрема категорія. Форма важить більше, ніж середнє: здоровий об'єкт заповнює всю фігуру, тоді як профіль із піками та провалами означає, що сила в одному вимірі маскує ризик в іншому.
Власність
AR USA LLCОсобистий обліковий запис
3 підписники18 публічних репозиторіївз груд. 2022 р.AR USA LLC
Цей репозиторій належить особистому обліковому запису. Проєкт з єдиним власником несе більший ризик безперервності, ніж підтримуваний організацією.
Пакетні екосистеми
| Реєстр | Пакет | Версія | Завантажень / міс | Версії | Остання публікація | Теги |
|---|---|---|---|---|---|---|
| npm | llama-cpp-pro | 0.2.4 | 495 | 3 | 9 днів тому | llamallama-cppllama.cppggufllmcapacitorcapacitor-pluginoffline-ailocal-llmiosandroidelectronpwabindingsaicmakecmake-jsprebuilt-binariesmetalcudavulkangrammarembeddingembeddingsrerankrerankingjson-grammarjson-schema-grammarfunctionsfunction-callingtoken-predictionspeculative-decodingtemperatureminptopktoppseedxtcjson-schemaraspberry-piself-hostedlocalcataimistraldeepseekqwenqwqgptgpt-osstypescriptlorabatchinggpumultimodalchat-completionionicannadata |
| crates.io | llama_engineвказує на інший репозиторій — не оцінюється | 0.1.1 | 134 | 2 | 164 дні тому | — |
Метрики за категоріями
Життєздатність
Чи живий проєкт — чи пишеться код і чи виходять релізи?
80
Активність розробки
74Добрий
Як обчислюється оцінка
| 36/36 | Свіжість push — останній push 3 дн. тому |
| 10.4/36 | Ритм комітів — 15/52 тижнів із комітами |
| 18/18 | Обсяг комітів — 127 комітів за останній рік |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Використані вхідні дані
| commits_last_year | 127 |
| human_commit_share | 1 |
| days_since_last_push | 3 |
| active_weeks_last_year | 15 |
Дисципліна релізів
90Відмінний
Як обчислюється оцінка
| 27/27 | Випускає релізи — опубліковано 2 релізів |
| 36/36 | Свіжість релізів — останній реліз 23 дн. тому |
| 27/27 | Ритм релізів — реліз кожні ~2,8 дн. |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
Використані вхідні дані
| releases_count | 2 |
| latest_release_tag | v0.2.2 |
| releases_from_tags | ні |
| days_since_latest_release | 23 |
| mean_days_between_releases | 2,8 |
Спільнота та впровадження
Чи має проєкт користувачів, завантаження, увагу та влаштовані умови для контриб’юторів?
42
Популярність і впровадження
15Критичний
Як обчислюється оцінка
| 12.6/60 | Зірки — 7 зірок |
| 2.5/25 | Форки — 3 форків |
| 0/15 | Спостерігачі — 0 спостерігачів |
Використані вхідні дані
| forks | 3 |
| stars | 7 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Здоров'я спільноти
70Добрий
Як обчислюється оцінка
| 22.5/22.5 | README |
| 22.5/22.5 | Ліцензія — визнана ліцензія (MIT) |
| 18/18 | Настанови CONTRIBUTING |
| 0/13.5 | Кодекс поведінки |
| 0/7.2 | Шаблон issue |
| 0/6.3 | Шаблон PR |
Використані вхідні дані
| has_readme | так |
| has_license | так |
| has_contributing | так |
| has_issue_template | ні |
| has_code_of_conduct | ні |
| has_pull_request_template | ні |
Впровадження в екосистемі (завантаження)
45У зоні ризику
Як обчислюється оцінка
| 35.9/80 | Щомісячні завантаження — 495 завантажень/місяць у npm |
| 0/20 | Залежні пакети в реєстрі — ця екосистема цього не повідомляє |
Використані вхідні дані
| packages | llama-cpp-pro |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 495 |
Виключено з оцінювання (немає даних або не застосовно): Залежні пакети в реєстрі. Залишкові ваги перенормовано.
Сталість та врядування
Чи переживе проєкт своїх людей — бас-фактор, реактивність, хто за ним стоїть і як супроводжуються пакети?
32
Стійкість мейнтейнерів (бас-фактор)
13Критичний
Як обчислюється оцінка
| 9/54 | Бас-фактор — на 1 контриб’ютор(ів) припадає половина всіх комітів |
| 0/22.5 | Розподіл комітів — головний контриб’ютор — автор 100% комітів |
| 1.4/13.5 | Широта контриб’юторів — 1 контриб’юторів |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
Використані вхідні дані
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
Реактивність на issue та PR
1Критичний
Як обчислюється оцінка
| 0/46.8 | Вирішення issue — закрито 0% issue |
| 0/38.3 | Прийняття PR — злито 0/1 вирішених PR |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Використані вхідні дані
| merged_prs | 0 |
| open_issues | 1 |
| closed_issues | 0 |
| issue_closed_ratio | 0 |
| closed_unmerged_prs | 1 |
Власність та опіка
39У зоні ризику
Як обчислюється оцінка
| 10/30 | Підтримка власника — особистий (користувацький) обліковий запис |
| 0/20 | Верифікований домен — не застосовно до користувацьких облікових записів |
| 4.3/25 | Охоплення власника — 3 підписників у arusatech |
| 16.6/25 | Послужний список — 18 публічних репозиторіїв, вік облікового запису ~3 р. |
Використані вхідні дані
| followers | 3 |
| owner_type | User |
| is_verified | — |
| owner_login | arusatech |
| public_repos | 18 |
| account_age_days | 1 338 |
Виключено з оцінювання (немає даних або не застосовно): Верифікований домен. Залишкові ваги перенормовано.
Супровід пакетів
92Відмінний
Як обчислюється оцінка
| 25/25 | Опубліковано й доступно — 1 пакет(ів) у npm |
| 35/35 | Свіжість публікацій — остання публікація 9 дн. тому |
| 12/20 | Історія версій — 3 опублікованих версій |
| 20/20 | Не застарілий — активний, не deprecated і не yanked |
Використані вхідні дані
| packages | llama-cpp-pro |
| ecosystems | npm |
| any_deprecated | ні |
| min_days_since_publish | 9 |
Інженерна якість
Чи наявні базові інженерні практики та документація?
66
Інженерні практики
60Помірний
Як обчислюється оцінка
| 24/24 | Процеси CI — 1 процес(ів) CI |
| 24/24 | Наявні тести |
| 0/16 | Конфігурація лінтера |
| 0/9.6 | Pre-commit-хуки |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — немає даних |
Використані вхідні дані
| has_ci | так |
| has_tests | так |
| has_editorconfig | ні |
| has_linter_config | ні |
| has_precommit_config | ні |
Виключено з оцінювання (немає даних або не застосовно): OpenSSF Scorecard: CI-Tests. Залишкові ваги перенормовано.
Документація
75Добрий
Як обчислюється оцінка
| 30/30 | README |
| 25/25 | Каталог документації |
| 0/15 | Сайт документації / домашня сторінка |
| 10/10 | Опис репозиторію |
| 0/10 | Теми |
| 10/10 | Wiki |
Використані вхідні дані
| topics | — |
| has_wiki | так |
| homepage | — |
| has_readme | так |
| has_docs_dir | так |
| has_description | так |
Безпека
Чи міцні видимі практики безпеки й ланцюга постачання, без непослабленої пов’язаності з юрисдикціями високого ризику?
28
Стан безпеки
28Критичний
Як обчислюється оцінка
| 0/7.5 | Binary-Artifacts — binaries present in source code |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — немає даних |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Ліцензія — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — немає даних |
| 2/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 4.5/7.5 | Vulnerabilities — 4 existing vulnerabilities detected |
Використані вхідні дані
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 2,8 |
Виключено з оцінювання (немає даних або не застосовно): ci_tests, packaging. Залишкові ваги перенормовано.
Готовність до ШІ
Наскільки репозиторій оснащений для розробки та супроводу за участі ШІ-агентів? Незалежний, експериментальний бейдж — вага 0.0, тож він подається окремо і не впливає на загальний індекс здоров'я.
62
Контекст і настанови для агентів
49У зоні ризику
Як обчислюється оцінка
| 45/45 | Інструкції для агентів — .cursor/rules/annadata-app-client.mdc |
| 0/15 | Машиночитана документація (llms.txt) |
| 3.7/40 | Читабельна історія комітів — намір зазначено у 7 з 100 людських комітів (структурований заголовок або пояснювальний текст) |
Використані вхідні дані
| has_llms_txt | ні |
| legible_history_share | 0,07 |
| agent_instruction_files | .cursor/rules/annadata-app-client.mdc |
| agent_instruction_max_bytes | 1 323 |
Як обчислюється оцінка
| 18/18 | Розгортання однією командою — ios/build-device/Makefile, ios/build-simulator/Makefile |
| 22/22 | Автоматизовані тести |
| 0/11 | Конфігурація лінтера / форматера |
| 11/11 | Статична перевірка типів — tsconfig.json |
| 10/10 | Відтворюване середовище — Dockerfile, lockfile |
| 10/10 | Підтверджена практика роботи з агентами — 7 з останніх 100 комітів створено агентом або з його зазначенням |
| 0/8 | Автоматизоване супроводження — автоматичних оновлень залежностей не виявлено |
| 4/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
Використані вхідні дані
| has_nix | ні |
| has_tests | так |
| lockfiles | Cargo.lock, package-lock.json |
| has_dockerfile | так |
| typed_language | ні |
| bootstrap_files | ios/build-device/Makefile, ios/build-simulator/Makefile |
| has_devcontainer | ні |
| has_linter_config | ні |
| typecheck_configs | tsconfig.json |
| agent_commit_share | 0,07 |
| toolchain_manifests | .release-stage/package/android/build.gradle, android/build.gradle, src-rust/Cargo.toml |
| dependency_bot_commit_share | 0 |
Читабельність коду для моделей
75Добрий
Як обчислюється оцінка
| 27/45 | Типізований код — Makefile з конфігурацією перевірки типів (tsconfig.json) |
| 48.1/55 | Керовані розміри файлів — 40/319 файлів вихідного коду понад 60 КБ |
Використані вхідні дані
| primary_language | Makefile |
| largest_source_bytes | 4 025 780 |
| source_files_sampled | 319 |
| oversized_source_files | 40 |
Машиночитні інтерфейси
40У зоні ризику
Як обчислюється оцінка
| 0/40 | Схема API (OpenAPI/GraphQL/proto) |
| 0/20 | Сервер MCP |
| 40/40 | Придатні до запуску приклади — examples |
Використані вхідні дані
| example_dirs | examples |
| has_mcp_signal | ні |
| api_schema_files | — |
Ключові факти
7зірок GitHub
1контриб'юторів
127комітів за останні 12 місяців
3днів від останнього пушу
2релізів
1бас-фактор
1відкритих issue
crates.io, Maven, npmпакетних екосистем
Попередження щодо збору даних
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
- crates package 'llama_engine' points at a different repository (https://github.com/stevedores-org/llama.rs); excluded from ecosystem scoring
- GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Докладніше
Історія зірок і форків 0 ★ / 3 ⇿
0Зірки
3Форки
Коли додано кожну зірку й форк — зібрано з GitHub і згруповано за днями. Кумулятивне зростання розміщено просто над денними додаваннями, з яких воно складається, тож їх видно одне проти одного: рівномірне органічне накопичення виглядає зовсім інакше, ніж різкий короткочасний сплеск. Там, де цю різницю можна виміряти, її подано як автентичність росту.
OpenSSF Scorecard 2.8 / 10
2.8сукупно
Незалежна, не прив'язана до інструментів оцінка безпеки від відкритого проєкту OpenSSF Scorecard. Кожна перевірка винагороджує практику безпеки, а не інструмент конкретного постачальника. Перевірки, які Scorecard не зміг визначити, позначено н/д і виключено з оцінки безпеки (вони ніколи не зараховуються як нуль).
| 0 | Binary-Artifacts | binaries present in source code |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| н/д | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| н/д | Packaging | packaging workflow not detected |
| 4 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 4 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 6 | Vulnerabilities | 4 existing vulnerabilities detected |
Прямі залежності 5
| Реєстр | Пакет | Обмеження версії | Маніфест |
|---|---|---|---|
| crates.io | wasm-bindgen | 0.2 | src-rust/Cargo.toml |
| crates.io | serde | 1 | src-rust/Cargo.toml |
| crates.io | serde_json | 1 | src-rust/Cargo.toml |
| crates.io | js-sys | 0.3 | src-rust/Cargo.toml |
| crates.io | web-sys | 0.3 | src-rust/Cargo.toml |
Усі залежності не зібрано
Не вдалося зібрати розв'язаний набір залежностей для цього звіту: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Звіт у форматі JSON машиночитний
{
"data": {
"repo": {
"topics": [],
"is_fork": false,
"size_kb": 362627,
"has_wiki": true,
"homepage": null,
"languages": {
"C": 8325138,
"C++": 6780922,
"Java": 186374,
"Ruby": 4658,
"Rust": 75678,
"CMake": 158182,
"Metal": 453302,
"Shell": 142687,
"Swift": 218949,
"Makefile": 15513561,
"Batchfile": 9060,
"JavaScript": 2247615,
"TypeScript": 366302,
"Objective-C": 371234
},
"pushed_at": "2026-07-27T23:56:23Z",
"created_at": "2025-08-29T04:21:16Z",
"owner_type": "User",
"updated_at": "2026-07-27T23:56:28Z",
"description": "Llama cpp + CapacitorJS support",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Makefile",
"significant_languages": [
"Makefile",
"C",
"C++"
]
},
"owner": {
"blog": "arusatech.com",
"name": "AR USA LLC",
"type": "User",
"login": "arusatech",
"company": "AR USA LLC",
"location": "Poway CA",
"followers": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/119571751?v=4",
"created_at": "2022-12-01T07:37:00Z",
"is_verified": null,
"public_repos": 18,
"account_age_days": 1338
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v0.2.2",
"kind": "patch",
"published_at": "2026-07-08T00:20:26Z"
},
{
"tag": "Rel-0.2.0",
"kind": "other",
"published_at": "2026-07-05T05:59:16Z"
}
],
"recent_commits": [
{
"oid": "dff9d7d451c4cd56875dfad6601fbbf7471e4876",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added OpenCL headers",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-27T23:56:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "953ac7ab4ca5f7d27d2ee1c80ec588c9fde96bca",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added submodules gitmodules",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:09:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f04d37ccdc9b29a4ffd424ff72d0952e60d5eb32",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added llama.cpp as submodules and re-engineered",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:02:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4eb7254654b5d785af4cab3232861f4a71194345",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added llama.cpp as sub module",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:01:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e927719fd80a575d9c1b6d09f886103598123924",
"body": null,
"is_bot": false,
"headline": "ADAS-89:Added vulkan and docker script",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-07-22T05:36:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c6e947c5f477593e885a7ed15235fde61430ab44",
"body": null,
"is_bot": false,
"headline": "0.2.3",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:15:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "df133427ad7e32a9f926891b44119eb910988699",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added keyword",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:15:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca2c942d1b217145f375c1c6fae8c6439a503ea5",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Fixed RootDir and README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:09:52Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "20c7c389d4ac58ffa89fb77ac6875451100dfd4d",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Updated pacakge.json",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T00:19:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d0e1a6de98b5e9ced5f333e41b254ce0edd5a325",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Build variant added in README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T23:40:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8bd407c3ee618bf1dc6f7f7aa2c81f4303a14b49",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added README.md",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T23:26:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ee103bd2b9824eacd2232d980293f10311a7652f",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added ipc handler and preload",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T21:30:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e2cd20598a127d4c331ba115590587891479a9a2",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Update package",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-16T17:33:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5f7d732581b67a39fb9f280c479eb5621397d6f9",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Trim all the build generated files",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-16T17:33:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fc4489483c699949c30878970baa3f118cb5b008",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Updated README and keyword",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T04:09:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca6006a061ff93bc9d0a64beebe639e428646ab0",
"body": "Align npm identity, docs, and packaging guards with full iOS/Android/Web/Desktop support.",
"is_bot": false,
"headline": "Rename package and GitHub repo to llama-cpp-pro.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T02:53:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0fed854516eecfdadb2149294fc6c1db1ef6edcc",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Format is corrected for local packages",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T02:03:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "634fbec7c7832ac53cf5600031764a4325f0267c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Readme.md",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T23:14:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "271427ed8fcf3bc858dccacfc21d90474ece237f",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Successful build of 0.2.2",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T23:10:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a1792d1d87db1347d29f568a6a46de964033f1eb",
"body": null,
"is_bot": false,
"headline": "0.2.2",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:45:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ceb448b46abe1962fae6f5a861781a036a6f6ae8",
"body": "Ensures npm always packs documentation with the explicit files whitelist.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Include README, LICENSE, and CHANGELOG in npm package files.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:45:27Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "1165c14b262dcfccad3e567b51a137f93698fdde",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Updated document for release",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:34:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c6cefcd7e9d74ba4753b38607cf41d3ed68f18af",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Feature support matrix updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T21:57:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "66ffb95c58847f91fd0520075d2ac1c8699c4456",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Desktop version to support 5 models in parallel",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T20:56:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3b67704943a2f6f65cb0bfe316301e23ee7055f0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in to support desktop version also",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T20:42:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a27a57c742d78d0fb958a818dc9dfe33412bc2e3",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Updated README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:56:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8a24f895c70f34785c07ebc127aa450d9df48304",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Pricnipal architect",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:42:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3bd27e85409ac3bedd7191f42be3d33d8f6949ae",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Author",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:31:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6c6ed125c358487101ddac1afb12d2b859f7223f",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Added Suppport by tag",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:28:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "88bd1cb35d658df14b29a52478c03494bae08faf",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Updated README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:18:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4215e9a7c8ae4f20ffbcd3d69d481628bd268b4e",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added wasm",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T05:13:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d67d87a21ad72ad9ff41da8c9be254d93f0b35ed",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added WASM fix",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T04:28:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4cab3670a1017ed2b578a8f9ecd0145e7afe861f",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in for android",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T03:40:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "feb08b38e2538f9b9ab0698d64d90502d1495429",
"body": null,
"is_bot": false,
"headline": "ADAS-88: embed script added",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:54:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4ad4dac1f691cff256fd3c1b6419b3421eaa4c00",
"body": null,
"is_bot": false,
"headline": "ADAS-88: ensure xcframework",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:21:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1f0ee6967ae7b154b76afff2540f488c5d3381b3",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Code cleanup",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:03:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8a6402c157d657e5dc91381d380a526f0da7b9cd",
"body": null,
"is_bot": false,
"headline": "ADAS-88: added ios fix -1",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T20:47:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b1b2041941be43b9d3634b4a795ae0c1cfa65b34",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Token increased to balance the speed",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T02:35:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "53f15b70da04aa2581f11c0fbbe04cd4a740bd9a",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Memeory set to 2GB",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T01:56:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1e8fc1b48dc590bb7cb54d957b8f98fab6bcf149",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial run with PWA",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T00:21:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "15a6c730b84d66097b05c8c87557f4a4bada477b",
"body": null,
"is_bot": false,
"headline": "ADAS-88: memumap- aded",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T23:40:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c01a97180df09487de0b9a545a47c06fdd23a38",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Build variants updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T16:51:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "89a2b382cec9f40f15345ccdf071a91de7b8c998",
"body": null,
"is_bot": false,
"headline": "ADAS-88: build script updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T08:08:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a0198e3f474bd4390244d124a0a8004111254286",
"body": null,
"is_bot": false,
"headline": "ADAS-88: added build system",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T07:40:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d462085cbbb87f40bef8ae3fed7cadf6a6733cb6",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Memory management by Andorid+ios",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T06:35:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8d873a58b6d0a4c4936bb1f78d4be5cc3f5dcf64",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Cleaning up docuemntation section",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T05:52:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cf3064730ac5039dde2e60ebfa77d0c1e3e0ad7c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in to support in android",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-07-02T16:47:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8d8ab13bfa3a5e3d1f122d3b9c2d8e1e0f938c08",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-02T02:25:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5335dd5f9685a96fbed919a8a2b04d19132c9e69",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added memory investigation",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-29T13:55:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d20cface5e71137b220a678ffbf9a2f3d033ed2d",
"body": null,
"is_bot": false,
"headline": "ADAS-88: BGE model loaded only one",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-28T00:58:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d68cbf965311d1304fb6e15265789b4299c50f1a",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix the review",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-28T00:27:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a81c72ab52d2fa2a22c2ff4888f1df76c36e6951",
"body": null,
"is_bot": false,
"headline": "ADAS-88: settign a n_ctx 384",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T22:31:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "253e78a15a6c98686651096a37a6d243a715f25c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: First working code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T21:36:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "626d398565595c4db5a2f8ed62c4574dc2d469e0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: model loads",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T08:08:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e7d7bd2d74303a384f2fbe5a1a9282949dd14369",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix for build failure",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T04:41:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "082331c9f7c4116544db43553e7c69ec6c478eac",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added JSPI",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T04:23:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "634d0c8413c026a1d3c2c932c00edddc594b9513",
"body": null,
"is_bot": false,
"headline": "ADAS-88: investigating on wasm",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T17:06:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "544a7ef7240ba97b518d2417268aacb782f7d5f9",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added error catch mechanism",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T04:19:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f81ec76b73cefd22a6c74f6d0a2eb362bdf11cf5",
"body": "…ride\n\nThe emcc MAIN_MODULE WASM imports wasm-bindgen helpers from the module\nname __wbindgen_placeholder__, but Emscripten only provides them under\nenv (via addToLibrary). WebAssembly.instantiate aborts because the\n__wbindgen_placeholder__ key is missing from the imports object.\n\nFix: ESM shim inst\n[…]\nports[__wbindgen_placeholder__] before calling instantiate. Streaming\ninstantiation with ArrayBuffer fallback. No WASM binary changes needed.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix __wbindgen_placeholder__ import via instantiateWasm over…",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T04:14:26Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "daa9b630d7bf0f24eb28b19af3092023a87c73f5",
"body": "load_model(bytes) peaked at ~2.1 GB WASM heap for a 697 MB model\n(wasm-bindgen param copy + fwrite to MEMFS + llama context), triggering\nGGML_ABORT -> abort() -> unreachable trap.\n\nSwitch to VFS chunked path: model_vfs_begin / model_vfs_write (32 MB\nchunks) / load_model_from_vfs reduces peak to ~1.4\n[…]\nngine.ts),\nESM shim template VFS exports (package-embed-wasm.mjs), build tooling\n(build-worker.mjs, copy-wasm-assets.mjs), and updated tests.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix WASM OOM — VFS chunked streaming for large model loads",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T01:21:01Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "6e098402c4c0cce02cca5c6967d3d72080df2a48",
"body": "Emscripten calls locateFile(llama_engine_emscripten.wasm) to resolve its\nbinary, but copy-wasm-assets ships the MAIN_MODULE binary under the stable\npublic name llama_engine.wasm. The missing file caused either a 404 or a\nstale SIDE_MODULE binary to load, both producing:\n LinkError: Import env.__sta\n[…]\n handler so both pkg/ and dist/wasm/ always point to the correct\nMAIN_MODULE binary. Patch also applied to dist/wasm/llama_engine.js on disk.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix WASM LinkError in locateFile shim template",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T01:00:15Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "e07648777e25e3f83249bf451cbe164066c10c8f",
"body": "Co-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: refactored and fixed the issues",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T00:06:14Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "a22861284fd552600892d6053091a3b5c1f4e772",
"body": null,
"is_bot": false,
"headline": "ADAS-88: updated build script",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T02:25:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "aa87b5b984a692abbf668fa656ee725bff6a1239",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix is in place",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T02:06:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "107b02f0cf46247a682ed9b1203fb66ee5c1d891",
"body": null,
"is_bot": false,
"headline": "ADAS-88: initial checkin of embed",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T01:19:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bc7f32f3fc6661e0bd83e9b68f412283180c52ba",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Fix for model not loading",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T00:48:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ad1dcdbb9477410c77dfac0ab95236e1596a7741",
"body": null,
"is_bot": false,
"headline": "ADAS-88: moved the docs in right place",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T00:34:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cddba13a6de67e961f3a04eda38c6c88b17e572c",
"body": null,
"is_bot": false,
"headline": "ADAS-88 Added .gitignore",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:38:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b2b058f6e8340dbeed415d67f240514f5ea74374",
"body": null,
"is_bot": false,
"headline": "ADAS-88: cleaned repo",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:37:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1be5b173957940ade3c10a67a445d00ea3850645",
"body": "Restore cfg-guarded ffi linkage, fail wasm32 builds without embed at compile time, and keep host-only checks compiling with explicit errors instead of scaffold responses.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Gate ffi behind embedded llama.cpp and reject non-embed wasm builds.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:22:41Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "ed077f52cdf5a79a178a1f2a67a026027b8f6159",
"body": "Drop legacy pkg-embed and wasm32-unknown-unknown artifacts from git, require ffi-only lib.rs, ignore those paths, and reject scaffold-sized wasm in verify-pack-artifacts.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Remove wasm scaffold paths and guard embedded wasm pack size.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:18:34Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "1a093e297862e5b3f5d3f1bbe2a5a6e049d77600",
"body": null,
"is_bot": false,
"headline": "ADAS-88: cleanup build",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:17:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9436dacf956910bab6652f7fa061fc9a26fdf778",
"body": null,
"is_bot": false,
"headline": "ADAS-88 : Updated build script with only embed and no mock",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "670d3b5a1ba239fdfddb6bd27720d02a0934aa43",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added build sequence",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "49592dd7c5c77a4e34b6ed9c10900ade959ec589",
"body": null,
"is_bot": false,
"headline": "ADAS-88: package.json npm pack updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a150a4a8003edcc80613517c09a2aa6bc3fe3d6c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: buils script added",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T19:54:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "738786b50640725ca6d19245478f6bbc7ce28a42",
"body": null,
"is_bot": false,
"headline": "ADAS-88: phase-1 imlementation of WASM",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-06-24T18:24:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1a75cb7a476b0690951b833637c9d6221094feb0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: debugging llama-wasm started",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T06:54:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5705315c541ba792daee43f6e90184d2e91f2710",
"body": null,
"is_bot": false,
"headline": "ADAS-87: Initial check-in to support PWA",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-23T23:25:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6d6556530c5811967a23fcb39d3dcea03d2fb65d",
"body": null,
"is_bot": false,
"headline": "ADAS-63: Error fix in tokenization/detokenization",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T21:27:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db7106575cd40cce993829cc50d00d831d9ab4ea",
"body": null,
"is_bot": false,
"headline": "ADAS-63: OpenAPI compatiable",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T21:03:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "124421ca89dc84c27aaf72fe79190b00901a528d",
"body": null,
"is_bot": false,
"headline": "ADAS-63: initial checkin for runing http on native platform",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-04-15T20:37:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "91f7c01e17f0c470c3309c831252af3fcf7c4225",
"body": null,
"is_bot": false,
"headline": "ADAS-40: temp ignore ref_code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T20:20:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8330f0a2730f9ecc5c6ab03fe178e43da1adfa15",
"body": null,
"is_bot": false,
"headline": "ADAS-40: remove ref-code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T20:20:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d357273375b98cb41ae4911bbdac26ea12498599",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added missing bridge ios",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-04-15T19:29:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fc108e6019ce366324a751ed16eaeb1d91ca2031",
"body": null,
"is_bot": false,
"headline": "ADAS-57: removing release files",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-03-18T01:04:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2e067c6f9a515b6b90f397b0f799063553aeb555",
"body": null,
"is_bot": false,
"headline": "ADAS-54: Adding support to capacitor-spm 8.0.0",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-18T23:09:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d9b85c35b1c910c1ba06c2deb7633711728bffdd",
"body": null,
"is_bot": false,
"headline": "ADAS-41: resolved symlink problem",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-08T21:24:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8bbed05a070eebfb9a36b16e7dc783cc88d4ca37",
"body": null,
"is_bot": false,
"headline": "ADS-41: added podpsec",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-08T19:44:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "50a5e8078176b1548346158b33450a481c4a388c",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added comment from developer",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-30T00:39:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3b96260534e3ebae612c0b6f77e37ce0a8c5c79f",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added version 0.1.1",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-24T06:22:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9a7ca0b806bb0b58fcb4399f058e711209a87f25",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added embedded logic",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-24T03:16:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d62cf8bfcc30dd35f526c6dddb2d7bf900ff5fcc",
"body": null,
"is_bot": false,
"headline": "ADAS-40 : Updated DOC",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-12T05:45:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d5ee16c261dac9d5e5659adf5301ac6345aadf7a",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added chat API",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-12T05:07:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1dc2d74f615edbdb729b7487973654c0afee8c5b",
"body": null,
"is_bot": false,
"headline": "ADAS-39: REL 0.0.20 pre release",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-10T19:20:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0e6969d4045f7161782f59a09a1ccfb6c23a7d55",
"body": null,
"is_bot": false,
"headline": "ADAS-39:Adding documentation",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:32:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f733fade5d9fc749d23a6f01a05d871f01dae172",
"body": null,
"is_bot": false,
"headline": "ADAS-39: Rel 0.0.19",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:30:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6bcbe7fb1d7350c36f32aa4ceb206f5e8832fe7e",
"body": null,
"is_bot": false,
"headline": "ADAS-39: Removed the non-existent json_schema field assignment",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:28:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8efc9cd0781342ac1463ffe403aaeb4ae24ba422",
"body": null,
"is_bot": false,
"headline": "ADAS-39: REL 18",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-08T04:24:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "16ed73483524b552282e3b48aead3ab2129da6e5",
"body": null,
"is_bot": false,
"headline": "ADAS-39:llama-cpp-arm64.so no suffix like v8a",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-08T03:48:13Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 2,
"commits_last_year": 127,
"latest_release_at": "2026-07-08T00:20:26Z",
"latest_release_tag": "v0.2.2",
"releases_from_tags": false,
"days_since_last_push": 3,
"active_weeks_last_year": 15,
"days_since_latest_release": 23,
"mean_days_between_releases": 2.8
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 71,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "llama-cpp-pro",
"exists": true,
"license": "MIT",
"keywords": [
"llama",
"llama-cpp",
"llama.cpp",
"gguf",
"llm",
"capacitor",
"capacitor-plugin",
"offline-ai",
"local-llm",
"ios",
"android",
"electron",
"pwa",
"bindings",
"ai",
"cmake",
"cmake-js",
"prebuilt-binaries",
"metal",
"cuda",
"vulkan",
"grammar",
"embedding",
"embeddings",
"rerank",
"reranking",
"json-grammar",
"json-schema-grammar",
"functions",
"function-calling",
"token-prediction",
"speculative-decoding",
"temperature",
"minP",
"topK",
"topP",
"seed",
"xtc",
"json-schema",
"raspberry-pi",
"self-hosted",
"local",
"catai",
"mistral",
"deepseek",
"qwen",
"qwq",
"gpt",
"gpt-oss",
"typescript",
"lora",
"batching",
"gpu",
"multimodal",
"chat-completion",
"ionic",
"annadata"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/llama-cpp-pro",
"is_deprecated": false,
"latest_version": "0.2.4",
"repository_url": "https://github.com/arusatech/llama-cpp-pro",
"versions_count": 3,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 1,
"monthly_downloads": 495,
"first_published_at": "2026-07-18T23:50:44.285000Z",
"latest_published_at": "2026-07-22T05:32:55.079000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 9
},
{
"name": "llama_engine",
"exists": true,
"license": "MIT",
"keywords": [],
"ecosystem": "crates",
"matches_repo": false,
"registry_url": "https://crates.io/crates/llama_engine",
"is_deprecated": false,
"latest_version": "0.1.1",
"repository_url": "https://github.com/stevedores-org/llama.rs",
"versions_count": 2,
"total_downloads": 1349,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 134,
"first_published_at": "2026-02-16T16:44:28.667528Z",
"latest_published_at": "2026-02-16T17:21:34.227036Z",
"latest_version_yanked": false,
"days_since_latest_publish": 164
}
]
},
"popularity": {
"forks": 3,
"stars": 7,
"watchers": 0,
"fork_history": {
"days": [
{
"date": "2025-11-03",
"count": 1
},
{
"date": "2026-02-05",
"count": 1
},
{
"date": "2026-06-08",
"count": 1
}
],
"complete": true,
"collected": 3,
"total_forks": 3
},
"star_history": null,
"open_issues_and_prs": 2
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [
"ios/build-device/Makefile",
"ios/build-simulator/Makefile"
],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [
"tsconfig.json"
],
"toolchain_manifests": [
".release-stage/package/android/build.gradle",
"android/build.gradle",
"src-rust/Cargo.toml"
],
"largest_source_bytes": 4025780,
"source_files_sampled": 319,
"oversized_source_files": 40,
"agent_instruction_files": [
".cursor/rules/annadata-app-client.mdc"
],
"agent_instruction_max_bytes": 1323
},
"dependencies": {
"manifests": [
"android/build.gradle",
"desktop/package.json",
"package.json",
"src-rust/Cargo.toml"
],
"advisories": {
"error": null,
"scope": null,
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"crates",
"maven",
"npm"
],
"dependencies": [
{
"name": "wasm-bindgen",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.2"
},
{
"name": "serde",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "1"
},
{
"name": "serde_json",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "1"
},
{
"name": "js-sys",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.3"
},
{
"name": "web-sys",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.3"
}
],
"all_dependencies": {
"error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"source": null,
"packages": [],
"collected": false,
"truncated": false,
"total_count": null,
"direct_count": null,
"indirect_count": null
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 0,
"open_issues": 1,
"closed_ratio": 0,
"closed_issues": 0,
"closed_unmerged_prs": 1
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "arusatech",
"commits": 108,
"avatar_url": "https://avatars.githubusercontent.com/u/119571751?v=4"
}
],
"contributors_sampled": 1,
"top_contributor_share": 1
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"ci.yml"
],
"has_docs_dir": true,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"Cargo.lock",
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 0,
"reason": "binaries present in source code",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 3,
"reason": "project has 1 contributing companies or organizations -- score normalized to 3",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 4,
"reason": "dependency not pinned by hash detected -- score normalized to 4",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 6,
"reason": "4 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "dff9d7d451c4cd56875dfad6601fbbf7471e4876",
"ran_at": "2026-07-31T14:04:28Z",
"aggregate_score": 2.8,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-27T23:57:24Z",
"oldest_open_prs": [
{
"number": 1,
"created_at": "2025-09-06T15:19:49Z",
"last_comment_at": "2025-09-06T15:19:50Z",
"last_comment_author": "cursor"
}
],
"last_merged_pr_at": null,
"ci_last_conclusion": "FAILURE",
"oldest_open_issues": [
{
"number": 2,
"created_at": "2025-10-06T14:35:31Z",
"last_comment_at": "2026-01-27T04:28:20Z",
"last_comment_author": "asif166037"
}
]
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/arusatech/llama-cpp-pro",
"host": "github.com",
"name": "llama-cpp-pro",
"owner": "arusatech"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 51,
"inputs": {
"security": 28,
"vitality": 80,
"community": 42,
"governance": 32,
"engineering": 66
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 80,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "good",
"name": "Development activity",
"note": null,
"notes": [],
"value": 74,
"inputs": {
"commits_last_year": 127,
"human_commit_share": 1,
"days_since_last_push": 3,
"active_weeks_last_year": 15
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 3 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 3
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "15/52 weeks with commits",
"points": 10.4,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 15
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "127 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 127
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 2,
"latest_release_tag": "v0.2.2",
"releases_from_tags": false,
"days_since_latest_release": 23,
"mean_days_between_releases": 2.8
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "2 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 2
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 23 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 23
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~2.8 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 2.8
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 3,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 3 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 3
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 42,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 15,
"inputs": {
"forks": 3,
"stars": 7,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "7 stars",
"points": 12.6,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 7
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "3 forks",
"points": 2.5,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 3
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 70,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "at_risk",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"packages": [
"llama-cpp-pro"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 495
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "495 downloads/month across npm",
"points": 35.9,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 495,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "at_risk",
"name": "Sustainability & Governance",
"value": 32,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 13,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 1,
"top_contributor_share": 1
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 100% of commits",
"points": 0,
"status": "missed",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 100
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "1 contributors",
"points": 1.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 1
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 3,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "critical",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"merged_prs": 0,
"open_issues": 1,
"closed_issues": 0,
"issue_closed_ratio": 0,
"closed_unmerged_prs": 1
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "0% of issues closed",
"points": 0,
"status": "missed",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 0
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "0/1 decided PRs merged",
"points": 0,
"status": "missed",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 0,
"decided": 1
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "at_risk",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 39,
"inputs": {
"followers": 3,
"owner_type": "User",
"is_verified": null,
"owner_login": "arusatech",
"public_repos": 18,
"account_age_days": 1338
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "3 followers of arusatech",
"points": 4.3,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 3,
"login": "arusatech"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "18 public repos, account ~3 yr old",
"points": 16.6,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 18
}
},
{
"code": "account_age_years",
"params": {
"years": 3
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 92,
"inputs": {
"packages": [
"llama-cpp-pro"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 9
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 9 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 9
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "3 published versions",
"points": 12,
"status": "partial",
"details": [
{
"code": "published_versions",
"params": {
"count": 3
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "moderate",
"name": "Engineering Quality",
"value": 66,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "1 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 1
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [],
"has_wiki": true,
"homepage": null,
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "critical",
"name": "Security",
"value": 28,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "critical",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"ci_tests",
"packaging"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 28,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 2.8
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "binaries present in source code",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 0.8,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 4",
"points": 2,
"status": "partial",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "4 existing vulnerabilities detected",
"points": 4.5,
"status": "partial",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 2
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "moderate",
"name": "AI Readiness",
"value": 62,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "at_risk",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 49,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.07,
"agent_instruction_files": [
".cursor/rules/annadata-app-client.mdc"
],
"agent_instruction_max_bytes": 1323
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": ".cursor/rules/annadata-app-client.mdc",
"points": 45,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".cursor/rules/annadata-app-client.mdc"
}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "7 of 100 human commits state their intent (structured subject or explanatory body)",
"points": 3.7,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 7,
"sampled": 100
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "good",
"name": "Verify loop (build / test / typecheck)",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"Cargo.lock",
"package-lock.json"
],
"has_dockerfile": true,
"typed_language": false,
"bootstrap_files": [
"ios/build-device/Makefile",
"ios/build-simulator/Makefile"
],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"tsconfig.json"
],
"agent_commit_share": 0.07,
"toolchain_manifests": [
".release-stage/package/android/build.gradle",
"android/build.gradle",
"src-rust/Cargo.toml"
],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "ios/build-device/Makefile, ios/build-simulator/Makefile",
"points": 18,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "ios/build-device/Makefile, ios/build-simulator/Makefile"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "tsconfig.json",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "tsconfig.json"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "7 of the last 100 commits agent-authored or agent-credited",
"points": 10,
"status": "met",
"details": [
{
"code": "agent_authored_commits",
"params": {
"count": 7,
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no automated dependency updates observed",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_dependency_automation",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 4",
"points": 4,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "good",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"primary_language": "Makefile",
"largest_source_bytes": 4025780,
"source_files_sampled": 319,
"oversized_source_files": 40
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Makefile with type-check config (tsconfig.json)",
"points": 27,
"status": "partial",
"details": [
{
"code": "typecheck_config_language",
"params": {
"files": "tsconfig.json",
"language": "Makefile"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "40/319 source files over 60KB",
"points": 48.1,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 319,
"oversized": 40
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token",
"crates package 'llama_engine' points at a different repository (https://github.com/stevedores-org/llama.rs); excluded from ecosystem scoring",
"GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository"
],
"report_type": "repository",
"generated_at": "2026-07-31T14:04:39.494739Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/a/arusatech/llama-cpp-pro.svg",
"full_name": "arusatech/llama-cpp-pro",
"license_state": "standard",
"license_spdx": "MIT"
}Оцінки — це сигнали, а не гарантії. Вони відображають публічно видимі практики на GitHub — це не аудит коду й не гарантія безпеки.
Відсутні дані виключаються, а ваги перенормовуються — нуль за відсутність ніколи не ставиться. Методологія версіонована й відкрита: метрики v1.13.0, схема v0.27.0 — повна методологія · вікі метрик.
Як окремий результат виглядає на тлі всього реєстру: сукупна статистика — npm, crates.io.