Öffentliches RegisterMittel
Software-GesundheitsberichtSchema 0.27.0 · Metriken 1.13.0 · 2026-07-31 14:04 UTC
arusatech / llama-cpp-pro
Llama cpp + CapacitorJS support
arusatech/llama-cpp-pro erreicht einen Gesundheitsindex von 51 von 100 und liegt damit im Bereich Mittel. Am stärksten schneidet es bei Vitality (80/100) ab, am schwächsten bei Security (28/100). Zuletzt vor 3 Tagen aktualisiert. Ein einzelner Mitwirkender trägt den Großteil der jüngsten Arbeit.
51
gesamt / 100Software-Gesundheitsindex
Metriken werden auf einer Skala von 1–100 in gewichtete Kategorien gruppiert. Der Gesamtwert beginnt als ihr Mittel; sobald öffentliche Evidenz die Richtlinie für Hochrisikojurisdiktionen auslöst, wird die Bewertung angepasst und erhält die Obergrenze 49 (Gefährdet). AI Readiness liegt außerhalb.
51
Exzellent85-100Vorbildlich; erfüllt im Wesentlichen alle geprüften Kriterien
Gut70-84Gesund; geringfügige Lücken
Mittel50-69Akzeptabel mit deutlichen Lücken; Überprüfung empfohlen
Gefährdet30-49Erhebliche Schwächen; eine Übernahme erfordert Vorsicht
Kritisch1-29Schwerwiegende Probleme (aufgegeben, nur ein Maintainer, keine Hygiene)
Bewertungsprofil
Jede Achse ist eine Kategorie. Die Form zählt mehr als der Durchschnitt — ein gesundes Projekt füllt die gesamte Fläche, während ein Profil aus Spitzen und Kratern bedeutet, dass Stärke in einer Dimension Risiken in einer anderen verdeckt.
Eigentümerschaft
AR USA LLCPersönliches Konto
3 Follower18 öffentliche Reposseit Dez. 2022AR USA LLC
Dieses Repository gehört einem persönlichen Konto. Ein Projekt mit nur einem Eigentümer trägt ein höheres Kontinuitätsrisiko als ein organisationsgetragenes.
Paket-Ökosysteme
| Registry | Paket | Version | Downloads / Monat | Versionen | Zuletzt veröffentlicht | Tags |
|---|---|---|---|---|---|---|
| npm | llama-cpp-pro | 0.2.4 | 495 | 3 | vor 9 Tagen | llamallama-cppllama.cppggufllmcapacitorcapacitor-pluginoffline-ailocal-llmiosandroidelectronpwabindingsaicmakecmake-jsprebuilt-binariesmetalcudavulkangrammarembeddingembeddingsrerankrerankingjson-grammarjson-schema-grammarfunctionsfunction-callingtoken-predictionspeculative-decodingtemperatureminptopktoppseedxtcjson-schemaraspberry-piself-hostedlocalcataimistraldeepseekqwenqwqgptgpt-osstypescriptlorabatchinggpumultimodalchat-completionionicannadata |
| crates.io | llama_engineverweist auf ein anderes Repo — nicht bewertet | 0.1.1 | 134 | 2 | vor 164 Tagen | — |
Metriken nach Kategorie
Vitalität
Lebt das Projekt — wird Code geschrieben und werden Releases ausgeliefert?
80
Wie die Bewertung erfolgt
| 36/36 | Push-Aktualität — letzter Push vor 3 Tagen |
| 10.4/36 | Commit-Rhythmus — 15/52 Wochen mit Commits |
| 18/18 | Commit-Volumen — 127 Commits im letzten Jahr |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Verwendete Eingangsdaten
| commits_last_year | 127 |
| human_commit_share | 1 |
| days_since_last_push | 3 |
| active_weeks_last_year | 15 |
Release-Disziplin
90Exzellent
Wie die Bewertung erfolgt
| 27/27 | Liefert Releases aus — 2 Releases veröffentlicht |
| 36/36 | Release-Aktualität — letztes Release vor 23 Tagen |
| 27/27 | Release-Rhythmus — ein Release etwa alle 2,8 Tage |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
Verwendete Eingangsdaten
| releases_count | 2 |
| latest_release_tag | v0.2.2 |
| releases_from_tags | nein |
| days_since_latest_release | 23 |
| mean_days_between_releases | 2,8 |
Community & Verbreitung
Hat das Projekt Nutzer, Downloads, Aufmerksamkeit und ein einladendes Umfeld für Beitragende?
42
Popularität & Verbreitung
15Kritisch
Wie die Bewertung erfolgt
| 12.6/60 | Stars — 7 Stars |
| 2.5/25 | Forks — 3 Forks |
| 0/15 | Watcher — 0 Watcher |
Verwendete Eingangsdaten
| forks | 3 |
| stars | 7 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Community-Gesundheit
70Gut
Wie die Bewertung erfolgt
| 22.5/22.5 | README |
| 22.5/22.5 | Lizenz — anerkannte Lizenz (MIT) |
| 18/18 | CONTRIBUTING-Leitfaden |
| 0/13.5 | Verhaltenskodex |
| 0/7.2 | Issue-Vorlage |
| 0/6.3 | PR-Vorlage |
Verwendete Eingangsdaten
| has_readme | ja |
| has_license | ja |
| has_contributing | ja |
| has_issue_template | nein |
| has_code_of_conduct | nein |
| has_pull_request_template | nein |
Ökosystem-Verbreitung (Downloads)
45Gefährdet
Wie die Bewertung erfolgt
| 35.9/80 | Downloads pro Monat — 495 Downloads/Monat über npm |
| 0/20 | Abhängige in der Registry — von diesem Ökosystem nicht ausgewiesen |
Verwendete Eingangsdaten
| packages | llama-cpp-pro |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 495 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Abhängige in der Registry. Die verbleibenden Gewichte wurden renormalisiert.
Nachhaltigkeit & Governance
Überdauert das Projekt die Menschen, die es tragen — Bus-Faktor, Reaktionsfähigkeit, Trägerschaft und Paketpflege?
32
Maintainer-Resilienz (Bus-Faktor)
13Kritisch
Wie die Bewertung erfolgt
| 9/54 | Bus-Faktor — 1 Beitragende decken die Hälfte aller Commits ab |
| 0/22.5 | Commit-Verteilung — wichtigste beitragende Person verfasste 100 % der Commits |
| 1.4/13.5 | Breite der Beitragenden — 1 Beitragende |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
Verwendete Eingangsdaten
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
Reaktionsfähigkeit bei Issues & PRs
1Kritisch
Wie die Bewertung erfolgt
| 0/46.8 | Issue-Lösungsquote — 0 % der Issues geschlossen |
| 0/38.3 | PR-Annahme — 0/1 entschiedene PRs gemergt |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Verwendete Eingangsdaten
| merged_prs | 0 |
| open_issues | 1 |
| closed_issues | 0 |
| issue_closed_ratio | 0 |
| closed_unmerged_prs | 1 |
Eigentümerschaft & Trägerschaft
39Gefährdet
Wie die Bewertung erfolgt
| 10/30 | Organisatorische Trägerschaft — persönliches (Nutzer-)Konto |
| 0/20 | Verifizierte Domain — für Nutzerkonten nicht anwendbar |
| 4.3/25 | Reichweite des Inhabers — 3 Follower von arusatech |
| 16.6/25 | Kontohistorie — 18 öffentliche Repos, Kontoalter ca. 3 Jahre |
Verwendete Eingangsdaten
| followers | 3 |
| owner_type | User |
| is_verified | — |
| owner_login | arusatech |
| public_repos | 18 |
| account_age_days | 1.338 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): Verifizierte Domain. Die verbleibenden Gewichte wurden renormalisiert.
Paketpflege
92Exzellent
Wie die Bewertung erfolgt
| 25/25 | Veröffentlicht & auflösbar — 1 Paket(e) auf npm |
| 35/35 | Veröffentlichungsaktualität — letzte Veröffentlichung vor 9 Tagen |
| 12/20 | Versionshistorie — 3 veröffentlichte Versionen |
| 20/20 | Nicht veraltet — aktiv, nicht veraltet oder zurückgezogen |
Verwendete Eingangsdaten
| packages | llama-cpp-pro |
| ecosystems | npm |
| any_deprecated | nein |
| min_days_since_publish | 9 |
Engineering-Qualität
Sind grundlegende Engineering- und Dokumentationspraktiken vorhanden?
66
Engineering-Praktiken
60Mittel
Wie die Bewertung erfolgt
| 24/24 | CI-Workflows — 1 Workflow(s) |
| 24/24 | Tests vorhanden |
| 0/16 | Linter-Konfiguration |
| 0/9.6 | Pre-Commit-Hooks |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — keine Daten |
Verwendete Eingangsdaten
| has_ci | ja |
| has_tests | ja |
| has_editorconfig | nein |
| has_linter_config | nein |
| has_precommit_config | nein |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): OpenSSF Scorecard: CI-Tests. Die verbleibenden Gewichte wurden renormalisiert.
Dokumentation
75Gut
Wie die Bewertung erfolgt
| 30/30 | README |
| 25/25 | Dokumentationsverzeichnis |
| 0/15 | Dokumentations-/Homepage-Site |
| 10/10 | Repository-Beschreibung |
| 0/10 | Topics |
| 10/10 | Wiki |
Verwendete Eingangsdaten
| topics | — |
| has_wiki | ja |
| homepage | — |
| has_readme | ja |
| has_docs_dir | ja |
| has_description | ja |
Sicherheit
Sind die sichtbaren Sicherheits- und Lieferkettenpraktiken belastbar, ohne ungeklärte Exposition gegenüber Hochrisikojurisdiktionen?
28
Sicherheitslage
28Kritisch
Wie die Bewertung erfolgt
| 0/7.5 | Binary-Artifacts — binaries present in source code |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — keine Daten |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Lizenz — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — keine Daten |
| 2/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 4.5/7.5 | Vulnerabilities — 4 existing vulnerabilities detected |
Verwendete Eingangsdaten
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 2,8 |
Von der Bewertung ausgeschlossen (keine Daten oder nicht anwendbar): ci_tests, packaging. Die verbleibenden Gewichte wurden renormalisiert.
AI Readiness
Wie gut ist das Repository dafür ausgestattet, mit KI-Coding-Agenten entwickelt und gepflegt zu werden? Ein unabhängiges, experimentelles Badge — Gewicht 0,0, es wird eigenständig ausgewiesen und verändert den Gesamt-Gesundheitswert nicht.
62
AI-Agentenkontext & Leitlinien
49Gefährdet
Wie die Bewertung erfolgt
| 45/45 | Agentenanweisungen — .cursor/rules/annadata-app-client.mdc |
| 0/15 | Maschinenlesbare Doku (llms.txt) |
| 3.7/40 | Lesbare Commit-Historie — 7 von 100 menschlichen Commits benennen ihre Absicht (strukturierter Betreff oder erläuternder Text) |
Verwendete Eingangsdaten
| has_llms_txt | nein |
| legible_history_share | 0,07 |
| agent_instruction_files | .cursor/rules/annadata-app-client.mdc |
| agent_instruction_max_bytes | 1.323 |
Wie die Bewertung erfolgt
| 18/18 | Bootstrap mit einem Befehl — ios/build-device/Makefile, ios/build-simulator/Makefile |
| 22/22 | Automatisierte Tests |
| 0/11 | Lint-/Format-Konfiguration |
| 11/11 | Statische Typprüfung — tsconfig.json |
| 10/10 | Reproduzierbare Umgebung — Dockerfile, lockfile |
| 10/10 | Belegte Agentenpraxis — 7 der letzten 100 Commits von Agenten verfasst oder ihnen zugeschrieben |
| 0/8 | Automatisierte Wartung — keine automatisierten Abhängigkeits-Updates beobachtet |
| 4/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
Verwendete Eingangsdaten
| has_nix | nein |
| has_tests | ja |
| lockfiles | Cargo.lock, package-lock.json |
| has_dockerfile | ja |
| typed_language | nein |
| bootstrap_files | ios/build-device/Makefile, ios/build-simulator/Makefile |
| has_devcontainer | nein |
| has_linter_config | nein |
| typecheck_configs | tsconfig.json |
| agent_commit_share | 0,07 |
| toolchain_manifests | .release-stage/package/android/build.gradle, android/build.gradle, src-rust/Cargo.toml |
| dependency_bot_commit_share | 0 |
Wie die Bewertung erfolgt
| 27/45 | Typprüfbarer Code — Makefile mit Typprüfungs-Konfiguration (tsconfig.json) |
| 48.1/55 | Handhabbare Dateigrößen — 40/319 Quelldateien über 60 KB |
Verwendete Eingangsdaten
| primary_language | Makefile |
| largest_source_bytes | 4.025.780 |
| source_files_sampled | 319 |
| oversized_source_files | 40 |
Maschinenlesbare AI-Schnittstellen
40Gefährdet
Wie die Bewertung erfolgt
| 0/40 | API-Schema (OpenAPI/GraphQL/proto) |
| 0/20 | MCP-Server |
| 40/40 | Lauffähige Beispiele — examples |
Verwendete Eingangsdaten
| example_dirs | examples |
| has_mcp_signal | nein |
| api_schema_files | — |
Eckdaten
7GitHub-Sterne
1Mitwirkende
127Commits, letzte 12 Monate
3Tage seit letztem Push
2Releases
1Bus-Faktor
1offene Issues
crates.io, Maven, npmPaket-Ökosysteme
Warnungen zur Datenerhebung
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
- crates package 'llama_engine' points at a different repository (https://github.com/stevedores-org/llama.rs); excluded from ecosystem scoring
- GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Weitere Details
Stern- und Fork-Verlauf 0 ★ / 3 ⇿
0Sterne
3Forks
Wann jeder Stern und Fork hinzugefügt wurde, von GitHub erfasst und nach Tagen gruppiert. Das kumulierte Wachstum steht direkt über den täglichen Zugängen, aus denen es besteht, sodass beide gegeneinander lesbar sind: stetiger organischer Zuwachs sieht ganz anders aus als ein abrupter, kurzlebiger Ausschlag. Wo dieser Unterschied messbar ist, wird er als Wachstumsauthentizität ausgewiesen.
OpenSSF Scorecard 2.8 / 10
2.8Gesamtwert
Unabhängige, werkzeugneutrale Sicherheitsbewertung durch das quelloffene OpenSSF Scorecard. Jede Prüfung honoriert eine Sicherheits-Praxis, nicht das Werkzeug eines bestimmten Anbieters. Prüfungen, die Scorecard nicht ermitteln konnte, sind mit k. A. markiert und vom Sicherheitswert ausgeschlossen (nie als null gezählt).
| 0 | Binary-Artifacts | binaries present in source code |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| k. A. | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| k. A. | Packaging | packaging workflow not detected |
| 4 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 4 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 6 | Vulnerabilities | 4 existing vulnerabilities detected |
Direkte Abhängigkeiten 5
| Registry | Paket | Versionsvorgabe | Manifest |
|---|---|---|---|
| crates.io | wasm-bindgen | 0.2 | src-rust/Cargo.toml |
| crates.io | serde | 1 | src-rust/Cargo.toml |
| crates.io | serde_json | 1 | src-rust/Cargo.toml |
| crates.io | js-sys | 0.3 | src-rust/Cargo.toml |
| crates.io | web-sys | 0.3 | src-rust/Cargo.toml |
Alle Abhängigkeiten nicht erhoben
Der aufgelöste Abhängigkeitssatz konnte für diesen Bericht nicht erhoben werden: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
JSON-Rohbericht maschinenlesbar
{
"data": {
"repo": {
"topics": [],
"is_fork": false,
"size_kb": 362627,
"has_wiki": true,
"homepage": null,
"languages": {
"C": 8325138,
"C++": 6780922,
"Java": 186374,
"Ruby": 4658,
"Rust": 75678,
"CMake": 158182,
"Metal": 453302,
"Shell": 142687,
"Swift": 218949,
"Makefile": 15513561,
"Batchfile": 9060,
"JavaScript": 2247615,
"TypeScript": 366302,
"Objective-C": 371234
},
"pushed_at": "2026-07-27T23:56:23Z",
"created_at": "2025-08-29T04:21:16Z",
"owner_type": "User",
"updated_at": "2026-07-27T23:56:28Z",
"description": "Llama cpp + CapacitorJS support",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Makefile",
"significant_languages": [
"Makefile",
"C",
"C++"
]
},
"owner": {
"blog": "arusatech.com",
"name": "AR USA LLC",
"type": "User",
"login": "arusatech",
"company": "AR USA LLC",
"location": "Poway CA",
"followers": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/119571751?v=4",
"created_at": "2022-12-01T07:37:00Z",
"is_verified": null,
"public_repos": 18,
"account_age_days": 1338
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v0.2.2",
"kind": "patch",
"published_at": "2026-07-08T00:20:26Z"
},
{
"tag": "Rel-0.2.0",
"kind": "other",
"published_at": "2026-07-05T05:59:16Z"
}
],
"recent_commits": [
{
"oid": "dff9d7d451c4cd56875dfad6601fbbf7471e4876",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added OpenCL headers",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-27T23:56:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "953ac7ab4ca5f7d27d2ee1c80ec588c9fde96bca",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added submodules gitmodules",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:09:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f04d37ccdc9b29a4ffd424ff72d0952e60d5eb32",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added llama.cpp as submodules and re-engineered",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:02:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4eb7254654b5d785af4cab3232861f4a71194345",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added llama.cpp as sub module",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:01:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e927719fd80a575d9c1b6d09f886103598123924",
"body": null,
"is_bot": false,
"headline": "ADAS-89:Added vulkan and docker script",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-07-22T05:36:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c6e947c5f477593e885a7ed15235fde61430ab44",
"body": null,
"is_bot": false,
"headline": "0.2.3",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:15:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "df133427ad7e32a9f926891b44119eb910988699",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added keyword",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:15:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca2c942d1b217145f375c1c6fae8c6439a503ea5",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Fixed RootDir and README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:09:52Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "20c7c389d4ac58ffa89fb77ac6875451100dfd4d",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Updated pacakge.json",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T00:19:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d0e1a6de98b5e9ced5f333e41b254ce0edd5a325",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Build variant added in README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T23:40:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8bd407c3ee618bf1dc6f7f7aa2c81f4303a14b49",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added README.md",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T23:26:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ee103bd2b9824eacd2232d980293f10311a7652f",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added ipc handler and preload",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T21:30:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e2cd20598a127d4c331ba115590587891479a9a2",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Update package",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-16T17:33:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5f7d732581b67a39fb9f280c479eb5621397d6f9",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Trim all the build generated files",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-16T17:33:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fc4489483c699949c30878970baa3f118cb5b008",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Updated README and keyword",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T04:09:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca6006a061ff93bc9d0a64beebe639e428646ab0",
"body": "Align npm identity, docs, and packaging guards with full iOS/Android/Web/Desktop support.",
"is_bot": false,
"headline": "Rename package and GitHub repo to llama-cpp-pro.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T02:53:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0fed854516eecfdadb2149294fc6c1db1ef6edcc",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Format is corrected for local packages",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T02:03:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "634fbec7c7832ac53cf5600031764a4325f0267c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Readme.md",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T23:14:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "271427ed8fcf3bc858dccacfc21d90474ece237f",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Successful build of 0.2.2",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T23:10:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a1792d1d87db1347d29f568a6a46de964033f1eb",
"body": null,
"is_bot": false,
"headline": "0.2.2",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:45:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ceb448b46abe1962fae6f5a861781a036a6f6ae8",
"body": "Ensures npm always packs documentation with the explicit files whitelist.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Include README, LICENSE, and CHANGELOG in npm package files.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:45:27Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "1165c14b262dcfccad3e567b51a137f93698fdde",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Updated document for release",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:34:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c6cefcd7e9d74ba4753b38607cf41d3ed68f18af",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Feature support matrix updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T21:57:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "66ffb95c58847f91fd0520075d2ac1c8699c4456",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Desktop version to support 5 models in parallel",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T20:56:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3b67704943a2f6f65cb0bfe316301e23ee7055f0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in to support desktop version also",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T20:42:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a27a57c742d78d0fb958a818dc9dfe33412bc2e3",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Updated README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:56:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8a24f895c70f34785c07ebc127aa450d9df48304",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Pricnipal architect",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:42:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3bd27e85409ac3bedd7191f42be3d33d8f6949ae",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Author",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:31:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6c6ed125c358487101ddac1afb12d2b859f7223f",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Added Suppport by tag",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:28:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "88bd1cb35d658df14b29a52478c03494bae08faf",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Updated README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:18:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4215e9a7c8ae4f20ffbcd3d69d481628bd268b4e",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added wasm",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T05:13:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d67d87a21ad72ad9ff41da8c9be254d93f0b35ed",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added WASM fix",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T04:28:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4cab3670a1017ed2b578a8f9ecd0145e7afe861f",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in for android",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T03:40:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "feb08b38e2538f9b9ab0698d64d90502d1495429",
"body": null,
"is_bot": false,
"headline": "ADAS-88: embed script added",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:54:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4ad4dac1f691cff256fd3c1b6419b3421eaa4c00",
"body": null,
"is_bot": false,
"headline": "ADAS-88: ensure xcframework",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:21:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1f0ee6967ae7b154b76afff2540f488c5d3381b3",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Code cleanup",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:03:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8a6402c157d657e5dc91381d380a526f0da7b9cd",
"body": null,
"is_bot": false,
"headline": "ADAS-88: added ios fix -1",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T20:47:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b1b2041941be43b9d3634b4a795ae0c1cfa65b34",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Token increased to balance the speed",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T02:35:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "53f15b70da04aa2581f11c0fbbe04cd4a740bd9a",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Memeory set to 2GB",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T01:56:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1e8fc1b48dc590bb7cb54d957b8f98fab6bcf149",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial run with PWA",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T00:21:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "15a6c730b84d66097b05c8c87557f4a4bada477b",
"body": null,
"is_bot": false,
"headline": "ADAS-88: memumap- aded",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T23:40:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c01a97180df09487de0b9a545a47c06fdd23a38",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Build variants updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T16:51:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "89a2b382cec9f40f15345ccdf071a91de7b8c998",
"body": null,
"is_bot": false,
"headline": "ADAS-88: build script updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T08:08:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a0198e3f474bd4390244d124a0a8004111254286",
"body": null,
"is_bot": false,
"headline": "ADAS-88: added build system",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T07:40:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d462085cbbb87f40bef8ae3fed7cadf6a6733cb6",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Memory management by Andorid+ios",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T06:35:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8d873a58b6d0a4c4936bb1f78d4be5cc3f5dcf64",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Cleaning up docuemntation section",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T05:52:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cf3064730ac5039dde2e60ebfa77d0c1e3e0ad7c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in to support in android",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-07-02T16:47:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8d8ab13bfa3a5e3d1f122d3b9c2d8e1e0f938c08",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-02T02:25:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5335dd5f9685a96fbed919a8a2b04d19132c9e69",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added memory investigation",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-29T13:55:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d20cface5e71137b220a678ffbf9a2f3d033ed2d",
"body": null,
"is_bot": false,
"headline": "ADAS-88: BGE model loaded only one",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-28T00:58:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d68cbf965311d1304fb6e15265789b4299c50f1a",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix the review",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-28T00:27:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a81c72ab52d2fa2a22c2ff4888f1df76c36e6951",
"body": null,
"is_bot": false,
"headline": "ADAS-88: settign a n_ctx 384",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T22:31:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "253e78a15a6c98686651096a37a6d243a715f25c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: First working code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T21:36:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "626d398565595c4db5a2f8ed62c4574dc2d469e0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: model loads",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T08:08:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e7d7bd2d74303a384f2fbe5a1a9282949dd14369",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix for build failure",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T04:41:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "082331c9f7c4116544db43553e7c69ec6c478eac",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added JSPI",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T04:23:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "634d0c8413c026a1d3c2c932c00edddc594b9513",
"body": null,
"is_bot": false,
"headline": "ADAS-88: investigating on wasm",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T17:06:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "544a7ef7240ba97b518d2417268aacb782f7d5f9",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added error catch mechanism",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T04:19:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f81ec76b73cefd22a6c74f6d0a2eb362bdf11cf5",
"body": "…ride\n\nThe emcc MAIN_MODULE WASM imports wasm-bindgen helpers from the module\nname __wbindgen_placeholder__, but Emscripten only provides them under\nenv (via addToLibrary). WebAssembly.instantiate aborts because the\n__wbindgen_placeholder__ key is missing from the imports object.\n\nFix: ESM shim inst\n[…]\nports[__wbindgen_placeholder__] before calling instantiate. Streaming\ninstantiation with ArrayBuffer fallback. No WASM binary changes needed.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix __wbindgen_placeholder__ import via instantiateWasm over…",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T04:14:26Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "daa9b630d7bf0f24eb28b19af3092023a87c73f5",
"body": "load_model(bytes) peaked at ~2.1 GB WASM heap for a 697 MB model\n(wasm-bindgen param copy + fwrite to MEMFS + llama context), triggering\nGGML_ABORT -> abort() -> unreachable trap.\n\nSwitch to VFS chunked path: model_vfs_begin / model_vfs_write (32 MB\nchunks) / load_model_from_vfs reduces peak to ~1.4\n[…]\nngine.ts),\nESM shim template VFS exports (package-embed-wasm.mjs), build tooling\n(build-worker.mjs, copy-wasm-assets.mjs), and updated tests.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix WASM OOM — VFS chunked streaming for large model loads",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T01:21:01Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "6e098402c4c0cce02cca5c6967d3d72080df2a48",
"body": "Emscripten calls locateFile(llama_engine_emscripten.wasm) to resolve its\nbinary, but copy-wasm-assets ships the MAIN_MODULE binary under the stable\npublic name llama_engine.wasm. The missing file caused either a 404 or a\nstale SIDE_MODULE binary to load, both producing:\n LinkError: Import env.__sta\n[…]\n handler so both pkg/ and dist/wasm/ always point to the correct\nMAIN_MODULE binary. Patch also applied to dist/wasm/llama_engine.js on disk.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix WASM LinkError in locateFile shim template",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T01:00:15Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "e07648777e25e3f83249bf451cbe164066c10c8f",
"body": "Co-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: refactored and fixed the issues",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T00:06:14Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "a22861284fd552600892d6053091a3b5c1f4e772",
"body": null,
"is_bot": false,
"headline": "ADAS-88: updated build script",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T02:25:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "aa87b5b984a692abbf668fa656ee725bff6a1239",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix is in place",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T02:06:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "107b02f0cf46247a682ed9b1203fb66ee5c1d891",
"body": null,
"is_bot": false,
"headline": "ADAS-88: initial checkin of embed",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T01:19:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bc7f32f3fc6661e0bd83e9b68f412283180c52ba",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Fix for model not loading",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T00:48:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ad1dcdbb9477410c77dfac0ab95236e1596a7741",
"body": null,
"is_bot": false,
"headline": "ADAS-88: moved the docs in right place",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T00:34:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cddba13a6de67e961f3a04eda38c6c88b17e572c",
"body": null,
"is_bot": false,
"headline": "ADAS-88 Added .gitignore",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:38:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b2b058f6e8340dbeed415d67f240514f5ea74374",
"body": null,
"is_bot": false,
"headline": "ADAS-88: cleaned repo",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:37:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1be5b173957940ade3c10a67a445d00ea3850645",
"body": "Restore cfg-guarded ffi linkage, fail wasm32 builds without embed at compile time, and keep host-only checks compiling with explicit errors instead of scaffold responses.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Gate ffi behind embedded llama.cpp and reject non-embed wasm builds.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:22:41Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "ed077f52cdf5a79a178a1f2a67a026027b8f6159",
"body": "Drop legacy pkg-embed and wasm32-unknown-unknown artifacts from git, require ffi-only lib.rs, ignore those paths, and reject scaffold-sized wasm in verify-pack-artifacts.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Remove wasm scaffold paths and guard embedded wasm pack size.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:18:34Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "1a093e297862e5b3f5d3f1bbe2a5a6e049d77600",
"body": null,
"is_bot": false,
"headline": "ADAS-88: cleanup build",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:17:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9436dacf956910bab6652f7fa061fc9a26fdf778",
"body": null,
"is_bot": false,
"headline": "ADAS-88 : Updated build script with only embed and no mock",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "670d3b5a1ba239fdfddb6bd27720d02a0934aa43",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added build sequence",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "49592dd7c5c77a4e34b6ed9c10900ade959ec589",
"body": null,
"is_bot": false,
"headline": "ADAS-88: package.json npm pack updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a150a4a8003edcc80613517c09a2aa6bc3fe3d6c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: buils script added",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T19:54:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "738786b50640725ca6d19245478f6bbc7ce28a42",
"body": null,
"is_bot": false,
"headline": "ADAS-88: phase-1 imlementation of WASM",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-06-24T18:24:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1a75cb7a476b0690951b833637c9d6221094feb0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: debugging llama-wasm started",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T06:54:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5705315c541ba792daee43f6e90184d2e91f2710",
"body": null,
"is_bot": false,
"headline": "ADAS-87: Initial check-in to support PWA",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-23T23:25:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6d6556530c5811967a23fcb39d3dcea03d2fb65d",
"body": null,
"is_bot": false,
"headline": "ADAS-63: Error fix in tokenization/detokenization",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T21:27:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db7106575cd40cce993829cc50d00d831d9ab4ea",
"body": null,
"is_bot": false,
"headline": "ADAS-63: OpenAPI compatiable",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T21:03:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "124421ca89dc84c27aaf72fe79190b00901a528d",
"body": null,
"is_bot": false,
"headline": "ADAS-63: initial checkin for runing http on native platform",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-04-15T20:37:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "91f7c01e17f0c470c3309c831252af3fcf7c4225",
"body": null,
"is_bot": false,
"headline": "ADAS-40: temp ignore ref_code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T20:20:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8330f0a2730f9ecc5c6ab03fe178e43da1adfa15",
"body": null,
"is_bot": false,
"headline": "ADAS-40: remove ref-code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T20:20:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d357273375b98cb41ae4911bbdac26ea12498599",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added missing bridge ios",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-04-15T19:29:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fc108e6019ce366324a751ed16eaeb1d91ca2031",
"body": null,
"is_bot": false,
"headline": "ADAS-57: removing release files",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-03-18T01:04:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2e067c6f9a515b6b90f397b0f799063553aeb555",
"body": null,
"is_bot": false,
"headline": "ADAS-54: Adding support to capacitor-spm 8.0.0",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-18T23:09:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d9b85c35b1c910c1ba06c2deb7633711728bffdd",
"body": null,
"is_bot": false,
"headline": "ADAS-41: resolved symlink problem",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-08T21:24:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8bbed05a070eebfb9a36b16e7dc783cc88d4ca37",
"body": null,
"is_bot": false,
"headline": "ADS-41: added podpsec",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-08T19:44:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "50a5e8078176b1548346158b33450a481c4a388c",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added comment from developer",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-30T00:39:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3b96260534e3ebae612c0b6f77e37ce0a8c5c79f",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added version 0.1.1",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-24T06:22:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9a7ca0b806bb0b58fcb4399f058e711209a87f25",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added embedded logic",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-24T03:16:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d62cf8bfcc30dd35f526c6dddb2d7bf900ff5fcc",
"body": null,
"is_bot": false,
"headline": "ADAS-40 : Updated DOC",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-12T05:45:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d5ee16c261dac9d5e5659adf5301ac6345aadf7a",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added chat API",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-12T05:07:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1dc2d74f615edbdb729b7487973654c0afee8c5b",
"body": null,
"is_bot": false,
"headline": "ADAS-39: REL 0.0.20 pre release",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-10T19:20:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0e6969d4045f7161782f59a09a1ccfb6c23a7d55",
"body": null,
"is_bot": false,
"headline": "ADAS-39:Adding documentation",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:32:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f733fade5d9fc749d23a6f01a05d871f01dae172",
"body": null,
"is_bot": false,
"headline": "ADAS-39: Rel 0.0.19",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:30:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6bcbe7fb1d7350c36f32aa4ceb206f5e8832fe7e",
"body": null,
"is_bot": false,
"headline": "ADAS-39: Removed the non-existent json_schema field assignment",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:28:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8efc9cd0781342ac1463ffe403aaeb4ae24ba422",
"body": null,
"is_bot": false,
"headline": "ADAS-39: REL 18",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-08T04:24:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "16ed73483524b552282e3b48aead3ab2129da6e5",
"body": null,
"is_bot": false,
"headline": "ADAS-39:llama-cpp-arm64.so no suffix like v8a",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-08T03:48:13Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 2,
"commits_last_year": 127,
"latest_release_at": "2026-07-08T00:20:26Z",
"latest_release_tag": "v0.2.2",
"releases_from_tags": false,
"days_since_last_push": 3,
"active_weeks_last_year": 15,
"days_since_latest_release": 23,
"mean_days_between_releases": 2.8
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 71,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "llama-cpp-pro",
"exists": true,
"license": "MIT",
"keywords": [
"llama",
"llama-cpp",
"llama.cpp",
"gguf",
"llm",
"capacitor",
"capacitor-plugin",
"offline-ai",
"local-llm",
"ios",
"android",
"electron",
"pwa",
"bindings",
"ai",
"cmake",
"cmake-js",
"prebuilt-binaries",
"metal",
"cuda",
"vulkan",
"grammar",
"embedding",
"embeddings",
"rerank",
"reranking",
"json-grammar",
"json-schema-grammar",
"functions",
"function-calling",
"token-prediction",
"speculative-decoding",
"temperature",
"minP",
"topK",
"topP",
"seed",
"xtc",
"json-schema",
"raspberry-pi",
"self-hosted",
"local",
"catai",
"mistral",
"deepseek",
"qwen",
"qwq",
"gpt",
"gpt-oss",
"typescript",
"lora",
"batching",
"gpu",
"multimodal",
"chat-completion",
"ionic",
"annadata"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/llama-cpp-pro",
"is_deprecated": false,
"latest_version": "0.2.4",
"repository_url": "https://github.com/arusatech/llama-cpp-pro",
"versions_count": 3,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 1,
"monthly_downloads": 495,
"first_published_at": "2026-07-18T23:50:44.285000Z",
"latest_published_at": "2026-07-22T05:32:55.079000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 9
},
{
"name": "llama_engine",
"exists": true,
"license": "MIT",
"keywords": [],
"ecosystem": "crates",
"matches_repo": false,
"registry_url": "https://crates.io/crates/llama_engine",
"is_deprecated": false,
"latest_version": "0.1.1",
"repository_url": "https://github.com/stevedores-org/llama.rs",
"versions_count": 2,
"total_downloads": 1349,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 134,
"first_published_at": "2026-02-16T16:44:28.667528Z",
"latest_published_at": "2026-02-16T17:21:34.227036Z",
"latest_version_yanked": false,
"days_since_latest_publish": 164
}
]
},
"popularity": {
"forks": 3,
"stars": 7,
"watchers": 0,
"fork_history": {
"days": [
{
"date": "2025-11-03",
"count": 1
},
{
"date": "2026-02-05",
"count": 1
},
{
"date": "2026-06-08",
"count": 1
}
],
"complete": true,
"collected": 3,
"total_forks": 3
},
"star_history": null,
"open_issues_and_prs": 2
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [
"ios/build-device/Makefile",
"ios/build-simulator/Makefile"
],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [
"tsconfig.json"
],
"toolchain_manifests": [
".release-stage/package/android/build.gradle",
"android/build.gradle",
"src-rust/Cargo.toml"
],
"largest_source_bytes": 4025780,
"source_files_sampled": 319,
"oversized_source_files": 40,
"agent_instruction_files": [
".cursor/rules/annadata-app-client.mdc"
],
"agent_instruction_max_bytes": 1323
},
"dependencies": {
"manifests": [
"android/build.gradle",
"desktop/package.json",
"package.json",
"src-rust/Cargo.toml"
],
"advisories": {
"error": null,
"scope": null,
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"crates",
"maven",
"npm"
],
"dependencies": [
{
"name": "wasm-bindgen",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.2"
},
{
"name": "serde",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "1"
},
{
"name": "serde_json",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "1"
},
{
"name": "js-sys",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.3"
},
{
"name": "web-sys",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.3"
}
],
"all_dependencies": {
"error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"source": null,
"packages": [],
"collected": false,
"truncated": false,
"total_count": null,
"direct_count": null,
"indirect_count": null
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 0,
"open_issues": 1,
"closed_ratio": 0,
"closed_issues": 0,
"closed_unmerged_prs": 1
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "arusatech",
"commits": 108,
"avatar_url": "https://avatars.githubusercontent.com/u/119571751?v=4"
}
],
"contributors_sampled": 1,
"top_contributor_share": 1
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"ci.yml"
],
"has_docs_dir": true,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"Cargo.lock",
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 0,
"reason": "binaries present in source code",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 3,
"reason": "project has 1 contributing companies or organizations -- score normalized to 3",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 4,
"reason": "dependency not pinned by hash detected -- score normalized to 4",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 6,
"reason": "4 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "dff9d7d451c4cd56875dfad6601fbbf7471e4876",
"ran_at": "2026-07-31T14:04:28Z",
"aggregate_score": 2.8,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-27T23:57:24Z",
"oldest_open_prs": [
{
"number": 1,
"created_at": "2025-09-06T15:19:49Z",
"last_comment_at": "2025-09-06T15:19:50Z",
"last_comment_author": "cursor"
}
],
"last_merged_pr_at": null,
"ci_last_conclusion": "FAILURE",
"oldest_open_issues": [
{
"number": 2,
"created_at": "2025-10-06T14:35:31Z",
"last_comment_at": "2026-01-27T04:28:20Z",
"last_comment_author": "asif166037"
}
]
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/arusatech/llama-cpp-pro",
"host": "github.com",
"name": "llama-cpp-pro",
"owner": "arusatech"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 51,
"inputs": {
"security": 28,
"vitality": 80,
"community": 42,
"governance": 32,
"engineering": 66
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 80,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "good",
"name": "Development activity",
"note": null,
"notes": [],
"value": 74,
"inputs": {
"commits_last_year": 127,
"human_commit_share": 1,
"days_since_last_push": 3,
"active_weeks_last_year": 15
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 3 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 3
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "15/52 weeks with commits",
"points": 10.4,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 15
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "127 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 127
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 2,
"latest_release_tag": "v0.2.2",
"releases_from_tags": false,
"days_since_latest_release": 23,
"mean_days_between_releases": 2.8
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "2 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 2
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 23 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 23
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~2.8 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 2.8
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 3,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 3 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 3
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 42,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 15,
"inputs": {
"forks": 3,
"stars": 7,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "7 stars",
"points": 12.6,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 7
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "3 forks",
"points": 2.5,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 3
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 70,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "at_risk",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"packages": [
"llama-cpp-pro"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 495
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "495 downloads/month across npm",
"points": 35.9,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 495,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "at_risk",
"name": "Sustainability & Governance",
"value": 32,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 13,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 1,
"top_contributor_share": 1
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 100% of commits",
"points": 0,
"status": "missed",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 100
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "1 contributors",
"points": 1.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 1
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 3,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "critical",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"merged_prs": 0,
"open_issues": 1,
"closed_issues": 0,
"issue_closed_ratio": 0,
"closed_unmerged_prs": 1
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "0% of issues closed",
"points": 0,
"status": "missed",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 0
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "0/1 decided PRs merged",
"points": 0,
"status": "missed",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 0,
"decided": 1
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "at_risk",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 39,
"inputs": {
"followers": 3,
"owner_type": "User",
"is_verified": null,
"owner_login": "arusatech",
"public_repos": 18,
"account_age_days": 1338
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "3 followers of arusatech",
"points": 4.3,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 3,
"login": "arusatech"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "18 public repos, account ~3 yr old",
"points": 16.6,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 18
}
},
{
"code": "account_age_years",
"params": {
"years": 3
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 92,
"inputs": {
"packages": [
"llama-cpp-pro"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 9
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 9 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 9
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "3 published versions",
"points": 12,
"status": "partial",
"details": [
{
"code": "published_versions",
"params": {
"count": 3
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "moderate",
"name": "Engineering Quality",
"value": 66,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "1 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 1
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [],
"has_wiki": true,
"homepage": null,
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "critical",
"name": "Security",
"value": 28,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "critical",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"ci_tests",
"packaging"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 28,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 2.8
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "binaries present in source code",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 0.8,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 4",
"points": 2,
"status": "partial",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "4 existing vulnerabilities detected",
"points": 4.5,
"status": "partial",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 2
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "moderate",
"name": "AI Readiness",
"value": 62,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "at_risk",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 49,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.07,
"agent_instruction_files": [
".cursor/rules/annadata-app-client.mdc"
],
"agent_instruction_max_bytes": 1323
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": ".cursor/rules/annadata-app-client.mdc",
"points": 45,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".cursor/rules/annadata-app-client.mdc"
}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "7 of 100 human commits state their intent (structured subject or explanatory body)",
"points": 3.7,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 7,
"sampled": 100
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "good",
"name": "Verify loop (build / test / typecheck)",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"Cargo.lock",
"package-lock.json"
],
"has_dockerfile": true,
"typed_language": false,
"bootstrap_files": [
"ios/build-device/Makefile",
"ios/build-simulator/Makefile"
],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"tsconfig.json"
],
"agent_commit_share": 0.07,
"toolchain_manifests": [
".release-stage/package/android/build.gradle",
"android/build.gradle",
"src-rust/Cargo.toml"
],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "ios/build-device/Makefile, ios/build-simulator/Makefile",
"points": 18,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "ios/build-device/Makefile, ios/build-simulator/Makefile"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "tsconfig.json",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "tsconfig.json"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "7 of the last 100 commits agent-authored or agent-credited",
"points": 10,
"status": "met",
"details": [
{
"code": "agent_authored_commits",
"params": {
"count": 7,
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no automated dependency updates observed",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_dependency_automation",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 4",
"points": 4,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "good",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"primary_language": "Makefile",
"largest_source_bytes": 4025780,
"source_files_sampled": 319,
"oversized_source_files": 40
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Makefile with type-check config (tsconfig.json)",
"points": 27,
"status": "partial",
"details": [
{
"code": "typecheck_config_language",
"params": {
"files": "tsconfig.json",
"language": "Makefile"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "40/319 source files over 60KB",
"points": 48.1,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 319,
"oversized": 40
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token",
"crates package 'llama_engine' points at a different repository (https://github.com/stevedores-org/llama.rs); excluded from ecosystem scoring",
"GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository"
],
"report_type": "repository",
"generated_at": "2026-07-31T14:04:39.494739Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/a/arusatech/llama-cpp-pro.svg",
"full_name": "arusatech/llama-cpp-pro",
"license_state": "standard",
"license_spdx": "MIT"
}Bewertungen sind Signale, keine Garantien. Sie spiegeln öffentlich sichtbare Praxis auf GitHub wider — kein Code-Audit und keine Sicherheitsgarantie.
Fehlende Daten werden ausgeschlossen und die Gewichte neu normiert, nie als null bewertet. Die Methodik ist versioniert und offen: Metriken v1.13.0, Schema v0.27.0 — vollständige Methodik · Metriken-Wiki.
Wie ein einzelnes Ergebnis im Gesamtregister steht: aggregierte Statistiken — npm, crates.io.