Registro públicoModerado
Informe de salud del softwareesquema 0.27.0 · métricas 1.13.0 · 2026-07-31 14:04 UTC
arusatech / llama-cpp-pro
Llama cpp + CapacitorJS support
arusatech/llama-cpp-pro tiene un índice de salud de 51 sobre 100, lo que lo sitúa en la banda Moderado. Su puntuación más alta es Vitality (80/100) y la más baja, Security (28/100). Se actualizó por última vez hace 3 días. Una sola persona concentra la mayor parte del trabajo reciente.
51
global / 100Índice de salud del software
Las métricas se agrupan en categorías ponderadas sobre una escala de 1 a 100. El resultado global parte de su media; cuando la evidencia pública activa la Política de Jurisdicciones de Alto Riesgo, la calificación se ajusta y recibe el límite 49 (En riesgo). Preparación para IA queda fuera.
51
Excelente85-100Ejemplar; cumple prácticamente todos los criterios evaluados
Bueno70-84Saludable; carencias menores
Moderado50-69Aceptable con carencias notables; se recomienda revisión
En riesgo30-49Debilidades significativas; su adopción exige cautela
Crítico1-29Problemas graves (proyecto abandonado, un solo mantenedor, sin higiene)
Perfil de puntuación
Cada eje es una categoría. La forma importa más que la media: un proyecto sano llena toda la figura, mientras que un perfil de picos y cráteres indica que la fortaleza en una dimensión enmascara el riesgo en otra.
Titularidad
AR USA LLCCuenta personal
3 seguidores18 repositorios públicosdesde dic 2022AR USA LLC
Este repositorio pertenece a una cuenta personal. Un proyecto con un único propietario conlleva más riesgo de continuidad que uno respaldado por una organización.
Ecosistemas de paquetes
| Registro | Paquete | Versión | Descargas / mes | Versiones | Última publicación | Etiquetas |
|---|---|---|---|---|---|---|
| npm | llama-cpp-pro | 0.2.4 | 495 | 3 | hace 9 días | llamallama-cppllama.cppggufllmcapacitorcapacitor-pluginoffline-ailocal-llmiosandroidelectronpwabindingsaicmakecmake-jsprebuilt-binariesmetalcudavulkangrammarembeddingembeddingsrerankrerankingjson-grammarjson-schema-grammarfunctionsfunction-callingtoken-predictionspeculative-decodingtemperatureminptopktoppseedxtcjson-schemaraspberry-piself-hostedlocalcataimistraldeepseekqwenqwqgptgpt-osstypescriptlorabatchinggpumultimodalchat-completionionicannadata |
| crates.io | llama_engineapunta a otro repositorio; no se puntúa | 0.1.1 | 134 | 2 | hace 164 días | — |
Métricas por categoría
Vitalidad
¿Está vivo el proyecto: se escribe código y se publican versiones?
80
Actividad de desarrollo
74Bueno
Cómo se puntúa
| 36/36 | Recencia de push — último push hace 3 días |
| 10.4/36 | Cadencia de commits — 15/52 semanas con commits |
| 18/18 | Volumen de commits — 127 commits en el último año |
| 10/10 | OpenSSF Scorecard: Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
Datos de entrada utilizados
| commits_last_year | 127 |
| human_commit_share | 1 |
| days_since_last_push | 3 |
| active_weeks_last_year | 15 |
Disciplina de publicación
90Excelente
Cómo se puntúa
| 27/27 | Publica versiones — 2 versiones publicadas |
| 36/36 | Recencia de las versiones — última versión hace 23 días |
| 27/27 | Cadencia de publicación — una versión cada ~2,8 días |
| 0/10 | OpenSSF Scorecard: Signed-Releases — Project has not signed or included provenance with any releases. |
Datos de entrada utilizados
| releases_count | 2 |
| latest_release_tag | v0.2.2 |
| releases_from_tags | no |
| days_since_latest_release | 23 |
| mean_days_between_releases | 2,8 |
Comunidad y Adopción
¿Tiene el proyecto usuarios, descargas, atención y unas condiciones acogedoras para quienes contribuyen?
42
Popularidad y adopción
15Crítico
Cómo se puntúa
| 12.6/60 | Estrellas — 7 estrellas |
| 2.5/25 | Forks — 3 forks |
| 0/15 | Observadores — 0 observadores |
Datos de entrada utilizados
| forks | 3 |
| stars | 7 |
| watchers | 0 |
| growth_state | unverified |
| growth_factor_pct | 100 |
| growth_unverified_reason | no_history |
Salud de la comunidad
70Bueno
Cómo se puntúa
| 22.5/22.5 | README |
| 22.5/22.5 | Licencia — licencia reconocida (MIT) |
| 18/18 | Guía CONTRIBUTING |
| 0/13.5 | Código de conducta |
| 0/7.2 | Plantilla de issues |
| 0/6.3 | Plantilla de PR |
Datos de entrada utilizados
| has_readme | sí |
| has_license | sí |
| has_contributing | sí |
| has_issue_template | no |
| has_code_of_conduct | no |
| has_pull_request_template | no |
Adopción en el ecosistema (descargas)
45En riesgo
Cómo se puntúa
| 35.9/80 | Descargas mensuales — 495 descargas/mes en npm |
| 0/20 | Dependientes en el registro — no lo informa este ecosistema |
Datos de entrada utilizados
| packages | llama-cpp-pro |
| dependents | — |
| ecosystems | npm |
| total_downloads | — |
| monthly_downloads | 495 |
Excluidos de la puntuación (sin datos o no aplicable): Dependientes en el registro. Los pesos restantes se han renormalizado.
Sostenibilidad y Gobernanza
¿Sobrevivirá el proyecto a sus personas: factor bus, capacidad de respuesta, quién lo respalda y mantenimiento del paquete?
32
Cómo se puntúa
| 9/54 | Factor bus — la mitad de los commits recae en 1 contribuyente(s) |
| 0/22.5 | Distribución de commits — el principal contribuyente firma el 100% de los commits |
| 1.4/13.5 | Amplitud de contribuyentes — 1 contribuyentes |
| 3/10 | OpenSSF Scorecard: Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
Datos de entrada utilizados
| bus_factor | 1 |
| contributors_sampled | 1 |
| top_contributor_share | 1 |
Cómo se puntúa
| 0/46.8 | Resolución de issues — 0% de issues cerradas |
| 0/38.3 | Aceptación de PR — 0/1 PR decididos fusionados |
| 0/15 | OpenSSF Scorecard: Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
Datos de entrada utilizados
| merged_prs | 0 |
| open_issues | 1 |
| closed_issues | 0 |
| issue_closed_ratio | 0 |
| closed_unmerged_prs | 1 |
Propiedad y custodia
39En riesgo
Cómo se puntúa
| 10/30 | Respaldo de la propiedad — cuenta personal (usuario) |
| 0/20 | Dominio verificado — no aplicable a cuentas de usuario |
| 4.3/25 | Alcance del propietario — 3 seguidores de arusatech |
| 16.6/25 | Trayectoria — 18 repos públicos, cuenta de ~3 años |
Datos de entrada utilizados
| followers | 3 |
| owner_type | User |
| is_verified | — |
| owner_login | arusatech |
| public_repos | 18 |
| account_age_days | 1338 |
Excluidos de la puntuación (sin datos o no aplicable): Dominio verificado. Los pesos restantes se han renormalizado.
Mantenimiento de paquetes
92Excelente
Cómo se puntúa
| 25/25 | Publicado y resoluble — 1 paquete(s) en npm |
| 35/35 | Recencia de publicación — última publicación hace 9 días |
| 12/20 | Historial de versiones — 3 versiones en el registro |
| 20/20 | No obsoleto — activo, ni obsoleto ni retirado |
Datos de entrada utilizados
| packages | llama-cpp-pro |
| ecosystems | npm |
| any_deprecated | no |
| min_days_since_publish | 9 |
Calidad de Ingeniería
¿Existen unas prácticas mínimas de ingeniería y documentación?
66
Prácticas de ingeniería
60Moderado
Cómo se puntúa
| 24/24 | Flujos de trabajo de CI — 1 flujo(s) de trabajo |
| 24/24 | Pruebas presentes |
| 0/16 | Configuración de linter |
| 0/9.6 | Hooks de pre-commit |
| 0/6.4 | .editorconfig |
| 0/20 | OpenSSF Scorecard: CI-Tests — sin datos |
Datos de entrada utilizados
| has_ci | sí |
| has_tests | sí |
| has_editorconfig | no |
| has_linter_config | no |
| has_precommit_config | no |
Excluidos de la puntuación (sin datos o no aplicable): OpenSSF Scorecard: CI-Tests. Los pesos restantes se han renormalizado.
Documentación
75Bueno
Cómo se puntúa
| 30/30 | README |
| 25/25 | Directorio de documentación |
| 0/15 | Sitio de documentación / página del proyecto |
| 10/10 | Descripción del repositorio |
| 0/10 | Topics |
| 10/10 | Wiki |
Datos de entrada utilizados
| topics | — |
| has_wiki | sí |
| homepage | — |
| has_readme | sí |
| has_docs_dir | sí |
| has_description | sí |
Seguridad
¿Son sólidas las prácticas visibles de seguridad y de cadena de suministro, sin exposición jurisdiccional de alto riesgo sin resolver?
28
Postura de seguridad
28Crítico
Cómo se puntúa
| 0/7.5 | Binary-Artifacts — binaries present in source code |
| 0/7.5 | Branch-Protection — branch protection not enabled on development/release branches |
| 0/2.5 | CI-Tests — sin datos |
| 0/2.5 | CII-Best-Practices — no effort to earn an OpenSSF best practices badge detected |
| 0/7.5 | Code-Review — Found 0/30 approved changesets -- score normalized to 0 |
| 0.8/2.5 | Contributors — project has 1 contributing companies or organizations -- score normalized to 3 |
| 10/10 | Dangerous-Workflow — no dangerous workflow patterns detected |
| 0/7.5 | Dependency-Update-Tool — no update tool detected |
| 0/5 | Fuzzing — project is not fuzzed |
| 2.5/2.5 | Licencia — license file detected |
| 7.5/7.5 | Maintained — 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| 0/5 | Packaging — sin datos |
| 2/5 | Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
| 0/5 | SAST — no SAST tool detected |
| 0/5 | Security-Policy — security policy file not detected |
| 0/7.5 | Signed-Releases — Project has not signed or included provenance with any releases. |
| 0/7.5 | Token-Permissions — detected GitHub workflow tokens with excessive permissions |
| 4.5/7.5 | Vulnerabilities — 4 existing vulnerabilities detected |
Datos de entrada utilizados
| source | openssf_scorecard |
| checks_evaluated | 16 |
| scorecard_version | v5.5.0 |
| checks_inconclusive | 2 |
| scorecard_aggregate | 2,8 |
Excluidos de la puntuación (sin datos o no aplicable): ci_tests, packaging. Los pesos restantes se han renormalizado.
Preparación para IA
¿Hasta qué punto está el repositorio preparado para desarrollarse y mantenerse con agentes de codificación de IA? Es una insignia independiente y experimental — peso 0,0, de modo que se presenta por separado y no afecta a la puntuación de salud global.
62
Contexto y guía para agentes
49En riesgo
Cómo se puntúa
| 45/45 | Instrucciones para agentes — .cursor/rules/annadata-app-client.mdc |
| 0/15 | Documentación legible por máquinas (llms.txt) |
| 3.7/40 | Historial de commits legible — 7 de 100 commits humanos declaran su intención (asunto estructurado o cuerpo explicativo) |
Datos de entrada utilizados
| has_llms_txt | no |
| legible_history_share | 0,07 |
| agent_instruction_files | .cursor/rules/annadata-app-client.mdc |
| agent_instruction_max_bytes | 1323 |
Cómo se puntúa
| 18/18 | Arranque con un solo comando — ios/build-device/Makefile, ios/build-simulator/Makefile |
| 22/22 | Pruebas automatizadas |
| 0/11 | Configuración de lint / formato |
| 11/11 | Verificación estática de tipos — tsconfig.json |
| 10/10 | Entorno reproducible — Dockerfile, lockfile |
| 10/10 | Práctica demostrada con agentes — 7 de los últimos 100 commits con autoría o crédito de agente |
| 0/8 | Mantenimiento automatizado — no se observan actualizaciones automáticas de dependencias |
| 4/10 | OpenSSF Scorecard: Pinned-Dependencies — dependency not pinned by hash detected -- score normalized to 4 |
Datos de entrada utilizados
| has_nix | no |
| has_tests | sí |
| lockfiles | Cargo.lock, package-lock.json |
| has_dockerfile | sí |
| typed_language | no |
| bootstrap_files | ios/build-device/Makefile, ios/build-simulator/Makefile |
| has_devcontainer | no |
| has_linter_config | no |
| typecheck_configs | tsconfig.json |
| agent_commit_share | 0,07 |
| toolchain_manifests | .release-stage/package/android/build.gradle, android/build.gradle, src-rust/Cargo.toml |
| dependency_bot_commit_share | 0 |
Cómo se puntúa
| 27/45 | Código verificable por tipos — Makefile con configuración de verificación de tipos (tsconfig.json) |
| 48.1/55 | Tamaños de archivo manejables — 40/319 archivos fuente de más de 60 KB |
Datos de entrada utilizados
| primary_language | Makefile |
| largest_source_bytes | 4.025.780 |
| source_files_sampled | 319 |
| oversized_source_files | 40 |
Interfaces legibles por máquina
40En riesgo
Cómo se puntúa
| 0/40 | Esquema de API (OpenAPI/GraphQL/proto) |
| 0/20 | Servidor MCP |
| 40/40 | Ejemplos ejecutables — examples |
Datos de entrada utilizados
| example_dirs | examples |
| has_mcp_signal | no |
| api_schema_files | — |
Datos clave
7estrellas de GitHub
1contribuidores
127commits en los últimos 12 meses
3días desde el último push
2versiones publicadas
1factor bus
1issues abiertas
crates.io, Maven, npmecosistemas de paquetes
Advertencias de recopilación de datos
- Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token
- crates package 'llama_engine' points at a different repository (https://github.com/stevedores-org/llama.rs); excluded from ecosystem scoring
- GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Más detalle
Historial de estrellas y forks 0 ★ / 3 ⇿
0Estrellas
3Forks
Cuándo se añadió cada estrella y fork, recopilado de GitHub y agrupado por día. El crecimiento acumulado se sitúa justo encima de las adiciones diarias que lo componen, de modo que ambos se leen en conjunto: la acumulación orgánica sostenida no se parece en nada a un pico abrupto y efímero. Cuando esa diferencia es medible, se informa como autenticidad del crecimiento.
OpenSSF Scorecard 2.8 / 10
2.8agregado
Evaluación de seguridad independiente y agnóstica en cuanto a herramientas, procedente del proyecto de código abierto OpenSSF Scorecard. Cada comprobación premia una práctica de seguridad, no la herramienta de un proveedor concreto. Las comprobaciones que Scorecard no pudo determinar se marcan como n/d y se excluyen de la puntuación de seguridad (nunca se cuentan como cero).
| 0 | Binary-Artifacts | binaries present in source code |
| 0 | Branch-Protection | branch protection not enabled on development/release branches |
| n/d | CI-Tests | no pull request found |
| 0 | CII-Best-Practices | no effort to earn an OpenSSF best practices badge detected |
| 0 | Code-Review | Found 0/30 approved changesets -- score normalized to 0 |
| 3 | Contributors | project has 1 contributing companies or organizations -- score normalized to 3 |
| 10 | Dangerous-Workflow | no dangerous workflow patterns detected |
| 0 | Dependency-Update-Tool | no update tool detected |
| 0 | Fuzzing | project is not fuzzed |
| 10 | License | license file detected |
| 10 | Maintained | 30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10 |
| n/d | Packaging | packaging workflow not detected |
| 4 | Pinned-Dependencies | dependency not pinned by hash detected -- score normalized to 4 |
| 0 | SAST | no SAST tool detected |
| 0 | Security-Policy | security policy file not detected |
| 0 | Signed-Releases | Project has not signed or included provenance with any releases. |
| 0 | Token-Permissions | detected GitHub workflow tokens with excessive permissions |
| 6 | Vulnerabilities | 4 existing vulnerabilities detected |
Dependencias directas 5
| Registro | Paquete | Restricción de versión | Manifiesto |
|---|---|---|---|
| crates.io | wasm-bindgen | 0.2 | src-rust/Cargo.toml |
| crates.io | serde | 1 | src-rust/Cargo.toml |
| crates.io | serde_json | 1 | src-rust/Cargo.toml |
| crates.io | js-sys | 0.3 | src-rust/Cargo.toml |
| crates.io | web-sys | 0.3 | src-rust/Cargo.toml |
Todas las dependencias no recopilado
No fue posible recopilar el conjunto de dependencias resuelto para este informe: GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository
Informe JSON sin procesar legible por máquina
{
"data": {
"repo": {
"topics": [],
"is_fork": false,
"size_kb": 362627,
"has_wiki": true,
"homepage": null,
"languages": {
"C": 8325138,
"C++": 6780922,
"Java": 186374,
"Ruby": 4658,
"Rust": 75678,
"CMake": 158182,
"Metal": 453302,
"Shell": 142687,
"Swift": 218949,
"Makefile": 15513561,
"Batchfile": 9060,
"JavaScript": 2247615,
"TypeScript": 366302,
"Objective-C": 371234
},
"pushed_at": "2026-07-27T23:56:23Z",
"created_at": "2025-08-29T04:21:16Z",
"owner_type": "User",
"updated_at": "2026-07-27T23:56:28Z",
"description": "Llama cpp + CapacitorJS support",
"is_archived": false,
"is_disabled": false,
"license_spdx": "MIT",
"default_branch": "main",
"license_spdx_raw": "MIT",
"primary_language": "Makefile",
"significant_languages": [
"Makefile",
"C",
"C++"
]
},
"owner": {
"blog": "arusatech.com",
"name": "AR USA LLC",
"type": "User",
"login": "arusatech",
"company": "AR USA LLC",
"location": "Poway CA",
"followers": 3,
"avatar_url": "https://avatars.githubusercontent.com/u/119571751?v=4",
"created_at": "2022-12-01T07:37:00Z",
"is_verified": null,
"public_repos": 18,
"account_age_days": 1338
},
"license": {
"state": "standard",
"spdx_id": "MIT",
"raw_spdx": "MIT",
"file_present": true,
"scorecard_found": true,
"profile_has_license": true
},
"activity": {
"releases": [
{
"tag": "v0.2.2",
"kind": "patch",
"published_at": "2026-07-08T00:20:26Z"
},
{
"tag": "Rel-0.2.0",
"kind": "other",
"published_at": "2026-07-05T05:59:16Z"
}
],
"recent_commits": [
{
"oid": "dff9d7d451c4cd56875dfad6601fbbf7471e4876",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added OpenCL headers",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-27T23:56:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "953ac7ab4ca5f7d27d2ee1c80ec588c9fde96bca",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added submodules gitmodules",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:09:55Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f04d37ccdc9b29a4ffd424ff72d0952e60d5eb32",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added llama.cpp as submodules and re-engineered",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:02:23Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4eb7254654b5d785af4cab3232861f4a71194345",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added llama.cpp as sub module",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-25T22:01:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e927719fd80a575d9c1b6d09f886103598123924",
"body": null,
"is_bot": false,
"headline": "ADAS-89:Added vulkan and docker script",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-07-22T05:36:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c6e947c5f477593e885a7ed15235fde61430ab44",
"body": null,
"is_bot": false,
"headline": "0.2.3",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:15:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "df133427ad7e32a9f926891b44119eb910988699",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added keyword",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:15:30Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca2c942d1b217145f375c1c6fae8c6439a503ea5",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Fixed RootDir and README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T01:09:52Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "20c7c389d4ac58ffa89fb77ac6875451100dfd4d",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Updated pacakge.json",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-19T00:19:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d0e1a6de98b5e9ced5f333e41b254ce0edd5a325",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Build variant added in README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T23:40:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8bd407c3ee618bf1dc6f7f7aa2c81f4303a14b49",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Added README.md",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T23:26:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ee103bd2b9824eacd2232d980293f10311a7652f",
"body": null,
"is_bot": false,
"headline": "ADAS-89: added ipc handler and preload",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-18T21:30:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e2cd20598a127d4c331ba115590587891479a9a2",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Update package",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-16T17:33:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5f7d732581b67a39fb9f280c479eb5621397d6f9",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Trim all the build generated files",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-16T17:33:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fc4489483c699949c30878970baa3f118cb5b008",
"body": null,
"is_bot": false,
"headline": "ADAS-89: Updated README and keyword",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T04:09:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ca6006a061ff93bc9d0a64beebe639e428646ab0",
"body": "Align npm identity, docs, and packaging guards with full iOS/Android/Web/Desktop support.",
"is_bot": false,
"headline": "Rename package and GitHub repo to llama-cpp-pro.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T02:53:36Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0fed854516eecfdadb2149294fc6c1db1ef6edcc",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Format is corrected for local packages",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-14T02:03:37Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "634fbec7c7832ac53cf5600031764a4325f0267c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Readme.md",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T23:14:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "271427ed8fcf3bc858dccacfc21d90474ece237f",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Successful build of 0.2.2",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T23:10:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a1792d1d87db1347d29f568a6a46de964033f1eb",
"body": null,
"is_bot": false,
"headline": "0.2.2",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:45:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ceb448b46abe1962fae6f5a861781a036a6f6ae8",
"body": "Ensures npm always packs documentation with the explicit files whitelist.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Include README, LICENSE, and CHANGELOG in npm package files.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:45:27Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "1165c14b262dcfccad3e567b51a137f93698fdde",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Updated document for release",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T22:34:58Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "c6cefcd7e9d74ba4753b38607cf41d3ed68f18af",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Feature support matrix updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T21:57:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "66ffb95c58847f91fd0520075d2ac1c8699c4456",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Desktop version to support 5 models in parallel",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T20:56:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3b67704943a2f6f65cb0bfe316301e23ee7055f0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in to support desktop version also",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-07T20:42:41Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a27a57c742d78d0fb958a818dc9dfe33412bc2e3",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Updated README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:56:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8a24f895c70f34785c07ebc127aa450d9df48304",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Pricnipal architect",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:42:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3bd27e85409ac3bedd7191f42be3d33d8f6949ae",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added Author",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:31:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6c6ed125c358487101ddac1afb12d2b859f7223f",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Added Suppport by tag",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:28:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "88bd1cb35d658df14b29a52478c03494bae08faf",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Updated README",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-06T01:18:33Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4215e9a7c8ae4f20ffbcd3d69d481628bd268b4e",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added wasm",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T05:13:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d67d87a21ad72ad9ff41da8c9be254d93f0b35ed",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added WASM fix",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T04:28:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4cab3670a1017ed2b578a8f9ecd0145e7afe861f",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in for android",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-05T03:40:50Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "feb08b38e2538f9b9ab0698d64d90502d1495429",
"body": null,
"is_bot": false,
"headline": "ADAS-88: embed script added",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:54:18Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "4ad4dac1f691cff256fd3c1b6419b3421eaa4c00",
"body": null,
"is_bot": false,
"headline": "ADAS-88: ensure xcframework",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:21:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1f0ee6967ae7b154b76afff2540f488c5d3381b3",
"body": null,
"is_bot": false,
"headline": "ADAS-88:Code cleanup",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T23:03:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8a6402c157d657e5dc91381d380a526f0da7b9cd",
"body": null,
"is_bot": false,
"headline": "ADAS-88: added ios fix -1",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T20:47:51Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b1b2041941be43b9d3634b4a795ae0c1cfa65b34",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Token increased to balance the speed",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T02:35:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "53f15b70da04aa2581f11c0fbbe04cd4a740bd9a",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Memeory set to 2GB",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T01:56:26Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1e8fc1b48dc590bb7cb54d957b8f98fab6bcf149",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial run with PWA",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-04T00:21:31Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "15a6c730b84d66097b05c8c87557f4a4bada477b",
"body": null,
"is_bot": false,
"headline": "ADAS-88: memumap- aded",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T23:40:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8c01a97180df09487de0b9a545a47c06fdd23a38",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Build variants updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T16:51:05Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "89a2b382cec9f40f15345ccdf071a91de7b8c998",
"body": null,
"is_bot": false,
"headline": "ADAS-88: build script updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T08:08:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a0198e3f474bd4390244d124a0a8004111254286",
"body": null,
"is_bot": false,
"headline": "ADAS-88: added build system",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T07:40:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d462085cbbb87f40bef8ae3fed7cadf6a6733cb6",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Memory management by Andorid+ios",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T06:35:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8d873a58b6d0a4c4936bb1f78d4be5cc3f5dcf64",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Cleaning up docuemntation section",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-03T05:52:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cf3064730ac5039dde2e60ebfa77d0c1e3e0ad7c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in to support in android",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-07-02T16:47:08Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8d8ab13bfa3a5e3d1f122d3b9c2d8e1e0f938c08",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Initial check-in",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-07-02T02:25:29Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5335dd5f9685a96fbed919a8a2b04d19132c9e69",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added memory investigation",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-29T13:55:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d20cface5e71137b220a678ffbf9a2f3d033ed2d",
"body": null,
"is_bot": false,
"headline": "ADAS-88: BGE model loaded only one",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-28T00:58:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d68cbf965311d1304fb6e15265789b4299c50f1a",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix the review",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-28T00:27:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a81c72ab52d2fa2a22c2ff4888f1df76c36e6951",
"body": null,
"is_bot": false,
"headline": "ADAS-88: settign a n_ctx 384",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T22:31:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "253e78a15a6c98686651096a37a6d243a715f25c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: First working code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T21:36:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "626d398565595c4db5a2f8ed62c4574dc2d469e0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: model loads",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T08:08:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "e7d7bd2d74303a384f2fbe5a1a9282949dd14369",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix for build failure",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T04:41:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "082331c9f7c4116544db43553e7c69ec6c478eac",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added JSPI",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-27T04:23:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "634d0c8413c026a1d3c2c932c00edddc594b9513",
"body": null,
"is_bot": false,
"headline": "ADAS-88: investigating on wasm",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T17:06:17Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "544a7ef7240ba97b518d2417268aacb782f7d5f9",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added error catch mechanism",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T04:19:59Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f81ec76b73cefd22a6c74f6d0a2eb362bdf11cf5",
"body": "…ride\n\nThe emcc MAIN_MODULE WASM imports wasm-bindgen helpers from the module\nname __wbindgen_placeholder__, but Emscripten only provides them under\nenv (via addToLibrary). WebAssembly.instantiate aborts because the\n__wbindgen_placeholder__ key is missing from the imports object.\n\nFix: ESM shim inst\n[…]\nports[__wbindgen_placeholder__] before calling instantiate. Streaming\ninstantiation with ArrayBuffer fallback. No WASM binary changes needed.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix __wbindgen_placeholder__ import via instantiateWasm over…",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T04:14:26Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "daa9b630d7bf0f24eb28b19af3092023a87c73f5",
"body": "load_model(bytes) peaked at ~2.1 GB WASM heap for a 697 MB model\n(wasm-bindgen param copy + fwrite to MEMFS + llama context), triggering\nGGML_ABORT -> abort() -> unreachable trap.\n\nSwitch to VFS chunked path: model_vfs_begin / model_vfs_write (32 MB\nchunks) / load_model_from_vfs reduces peak to ~1.4\n[…]\nngine.ts),\nESM shim template VFS exports (package-embed-wasm.mjs), build tooling\n(build-worker.mjs, copy-wasm-assets.mjs), and updated tests.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix WASM OOM — VFS chunked streaming for large model loads",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T01:21:01Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "6e098402c4c0cce02cca5c6967d3d72080df2a48",
"body": "Emscripten calls locateFile(llama_engine_emscripten.wasm) to resolve its\nbinary, but copy-wasm-assets ships the MAIN_MODULE binary under the stable\npublic name llama_engine.wasm. The missing file caused either a 404 or a\nstale SIDE_MODULE binary to load, both producing:\n LinkError: Import env.__sta\n[…]\n handler so both pkg/ and dist/wasm/ always point to the correct\nMAIN_MODULE binary. Patch also applied to dist/wasm/llama_engine.js on disk.\n\nCo-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: fix WASM LinkError in locateFile shim template",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T01:00:15Z",
"body_truncated": true,
"is_coding_agent": true
},
{
"oid": "e07648777e25e3f83249bf451cbe164066c10c8f",
"body": "Co-Authored-By: Claude Sonnet 4.6 <noreply@anthropic.com>",
"is_bot": false,
"headline": "ADAS-88: refactored and fixed the issues",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-26T00:06:14Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "a22861284fd552600892d6053091a3b5c1f4e772",
"body": null,
"is_bot": false,
"headline": "ADAS-88: updated build script",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T02:25:13Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "aa87b5b984a692abbf668fa656ee725bff6a1239",
"body": null,
"is_bot": false,
"headline": "ADAS-88: fix is in place",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T02:06:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "107b02f0cf46247a682ed9b1203fb66ee5c1d891",
"body": null,
"is_bot": false,
"headline": "ADAS-88: initial checkin of embed",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T01:19:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "bc7f32f3fc6661e0bd83e9b68f412283180c52ba",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Fix for model not loading",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T00:48:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "ad1dcdbb9477410c77dfac0ab95236e1596a7741",
"body": null,
"is_bot": false,
"headline": "ADAS-88: moved the docs in right place",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-25T00:34:10Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "cddba13a6de67e961f3a04eda38c6c88b17e572c",
"body": null,
"is_bot": false,
"headline": "ADAS-88 Added .gitignore",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:38:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "b2b058f6e8340dbeed415d67f240514f5ea74374",
"body": null,
"is_bot": false,
"headline": "ADAS-88: cleaned repo",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:37:57Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1be5b173957940ade3c10a67a445d00ea3850645",
"body": "Restore cfg-guarded ffi linkage, fail wasm32 builds without embed at compile time, and keep host-only checks compiling with explicit errors instead of scaffold responses.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Gate ffi behind embedded llama.cpp and reject non-embed wasm builds.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:22:41Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "ed077f52cdf5a79a178a1f2a67a026027b8f6159",
"body": "Drop legacy pkg-embed and wasm32-unknown-unknown artifacts from git, require ffi-only lib.rs, ignore those paths, and reject scaffold-sized wasm in verify-pack-artifacts.\n\nCo-authored-by: Cursor <cursoragent@cursor.com>",
"is_bot": false,
"headline": "Remove wasm scaffold paths and guard embedded wasm pack size.",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:18:34Z",
"body_truncated": false,
"is_coding_agent": true
},
{
"oid": "1a093e297862e5b3f5d3f1bbe2a5a6e049d77600",
"body": null,
"is_bot": false,
"headline": "ADAS-88: cleanup build",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:17:22Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9436dacf956910bab6652f7fa061fc9a26fdf778",
"body": null,
"is_bot": false,
"headline": "ADAS-88 : Updated build script with only embed and no mock",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:48Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "670d3b5a1ba239fdfddb6bd27720d02a0934aa43",
"body": null,
"is_bot": false,
"headline": "ADAS-88: Added build sequence",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "49592dd7c5c77a4e34b6ed9c10900ade959ec589",
"body": null,
"is_bot": false,
"headline": "ADAS-88: package.json npm pack updated",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T22:01:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "a150a4a8003edcc80613517c09a2aa6bc3fe3d6c",
"body": null,
"is_bot": false,
"headline": "ADAS-88: buils script added",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T19:54:54Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "738786b50640725ca6d19245478f6bbc7ce28a42",
"body": null,
"is_bot": false,
"headline": "ADAS-88: phase-1 imlementation of WASM",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-06-24T18:24:25Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1a75cb7a476b0690951b833637c9d6221094feb0",
"body": null,
"is_bot": false,
"headline": "ADAS-88: debugging llama-wasm started",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-24T06:54:34Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "5705315c541ba792daee43f6e90184d2e91f2710",
"body": null,
"is_bot": false,
"headline": "ADAS-87: Initial check-in to support PWA",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-06-23T23:25:38Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6d6556530c5811967a23fcb39d3dcea03d2fb65d",
"body": null,
"is_bot": false,
"headline": "ADAS-63: Error fix in tokenization/detokenization",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T21:27:35Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "db7106575cd40cce993829cc50d00d831d9ab4ea",
"body": null,
"is_bot": false,
"headline": "ADAS-63: OpenAPI compatiable",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T21:03:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "124421ca89dc84c27aaf72fe79190b00901a528d",
"body": null,
"is_bot": false,
"headline": "ADAS-63: initial checkin for runing http on native platform",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-04-15T20:37:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "91f7c01e17f0c470c3309c831252af3fcf7c4225",
"body": null,
"is_bot": false,
"headline": "ADAS-40: temp ignore ref_code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T20:20:27Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8330f0a2730f9ecc5c6ab03fe178e43da1adfa15",
"body": null,
"is_bot": false,
"headline": "ADAS-40: remove ref-code",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-04-15T20:20:14Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d357273375b98cb41ae4911bbdac26ea12498599",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added missing bridge ios",
"author_name": "Yakub Mohammad",
"author_login": null,
"committed_at": "2026-04-15T19:29:04Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "fc108e6019ce366324a751ed16eaeb1d91ca2031",
"body": null,
"is_bot": false,
"headline": "ADAS-57: removing release files",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-03-18T01:04:28Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "2e067c6f9a515b6b90f397b0f799063553aeb555",
"body": null,
"is_bot": false,
"headline": "ADAS-54: Adding support to capacitor-spm 8.0.0",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-18T23:09:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d9b85c35b1c910c1ba06c2deb7633711728bffdd",
"body": null,
"is_bot": false,
"headline": "ADAS-41: resolved symlink problem",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-08T21:24:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8bbed05a070eebfb9a36b16e7dc783cc88d4ca37",
"body": null,
"is_bot": false,
"headline": "ADS-41: added podpsec",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-02-08T19:44:19Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "50a5e8078176b1548346158b33450a481c4a388c",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added comment from developer",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-30T00:39:45Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "3b96260534e3ebae612c0b6f77e37ce0a8c5c79f",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added version 0.1.1",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-24T06:22:06Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "9a7ca0b806bb0b58fcb4399f058e711209a87f25",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added embedded logic",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2026-01-24T03:16:15Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d62cf8bfcc30dd35f526c6dddb2d7bf900ff5fcc",
"body": null,
"is_bot": false,
"headline": "ADAS-40 : Updated DOC",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-12T05:45:16Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "d5ee16c261dac9d5e5659adf5301ac6345aadf7a",
"body": null,
"is_bot": false,
"headline": "ADAS-40: Added chat API",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-12T05:07:09Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "1dc2d74f615edbdb729b7487973654c0afee8c5b",
"body": null,
"is_bot": false,
"headline": "ADAS-39: REL 0.0.20 pre release",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-10T19:20:40Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "0e6969d4045f7161782f59a09a1ccfb6c23a7d55",
"body": null,
"is_bot": false,
"headline": "ADAS-39:Adding documentation",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:32:02Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "f733fade5d9fc749d23a6f01a05d871f01dae172",
"body": null,
"is_bot": false,
"headline": "ADAS-39: Rel 0.0.19",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:30:11Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "6bcbe7fb1d7350c36f32aa4ceb206f5e8832fe7e",
"body": null,
"is_bot": false,
"headline": "ADAS-39: Removed the non-existent json_schema field assignment",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-09T02:28:07Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "8efc9cd0781342ac1463ffe403aaeb4ae24ba422",
"body": null,
"is_bot": false,
"headline": "ADAS-39: REL 18",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-08T04:24:12Z",
"body_truncated": false,
"is_coding_agent": false
},
{
"oid": "16ed73483524b552282e3b48aead3ab2129da6e5",
"body": null,
"is_bot": false,
"headline": "ADAS-39:llama-cpp-arm64.so no suffix like v8a",
"author_name": "Yakub Mohammad",
"author_login": "arusatech",
"committed_at": "2025-09-08T03:48:13Z",
"body_truncated": false,
"is_coding_agent": false
}
],
"releases_count": 2,
"commits_last_year": 127,
"latest_release_at": "2026-07-08T00:20:26Z",
"latest_release_tag": "v0.2.2",
"releases_from_tags": false,
"days_since_last_push": 3,
"active_weeks_last_year": 15,
"days_since_latest_release": 23,
"mean_days_between_releases": 2.8
},
"community": {
"has_readme": true,
"has_license": true,
"has_description": true,
"has_contributing": true,
"health_percentage": 71,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"ecosystem": {
"packages": [
{
"name": "llama-cpp-pro",
"exists": true,
"license": "MIT",
"keywords": [
"llama",
"llama-cpp",
"llama.cpp",
"gguf",
"llm",
"capacitor",
"capacitor-plugin",
"offline-ai",
"local-llm",
"ios",
"android",
"electron",
"pwa",
"bindings",
"ai",
"cmake",
"cmake-js",
"prebuilt-binaries",
"metal",
"cuda",
"vulkan",
"grammar",
"embedding",
"embeddings",
"rerank",
"reranking",
"json-grammar",
"json-schema-grammar",
"functions",
"function-calling",
"token-prediction",
"speculative-decoding",
"temperature",
"minP",
"topK",
"topP",
"seed",
"xtc",
"json-schema",
"raspberry-pi",
"self-hosted",
"local",
"catai",
"mistral",
"deepseek",
"qwen",
"qwq",
"gpt",
"gpt-oss",
"typescript",
"lora",
"batching",
"gpu",
"multimodal",
"chat-completion",
"ionic",
"annadata"
],
"ecosystem": "npm",
"matches_repo": true,
"registry_url": "https://www.npmjs.com/package/llama-cpp-pro",
"is_deprecated": false,
"latest_version": "0.2.4",
"repository_url": "https://github.com/arusatech/llama-cpp-pro",
"versions_count": 3,
"total_downloads": null,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": 1,
"monthly_downloads": 495,
"first_published_at": "2026-07-18T23:50:44.285000Z",
"latest_published_at": "2026-07-22T05:32:55.079000Z",
"latest_version_yanked": null,
"days_since_latest_publish": 9
},
{
"name": "llama_engine",
"exists": true,
"license": "MIT",
"keywords": [],
"ecosystem": "crates",
"matches_repo": false,
"registry_url": "https://crates.io/crates/llama_engine",
"is_deprecated": false,
"latest_version": "0.1.1",
"repository_url": "https://github.com/stevedores-org/llama.rs",
"versions_count": 2,
"total_downloads": 1349,
"dependents_count": null,
"deprecation_note": null,
"maintainers_count": null,
"monthly_downloads": 134,
"first_published_at": "2026-02-16T16:44:28.667528Z",
"latest_published_at": "2026-02-16T17:21:34.227036Z",
"latest_version_yanked": false,
"days_since_latest_publish": 164
}
]
},
"popularity": {
"forks": 3,
"stars": 7,
"watchers": 0,
"fork_history": {
"days": [
{
"date": "2025-11-03",
"count": 1
},
{
"date": "2026-02-05",
"count": 1
},
{
"date": "2026-06-08",
"count": 1
}
],
"complete": true,
"collected": 3,
"total_forks": 3
},
"star_history": null,
"open_issues_and_prs": 2
},
"ai_readiness": {
"has_nix": false,
"example_dirs": [
"examples"
],
"has_llms_txt": false,
"has_dockerfile": true,
"has_mcp_signal": false,
"bootstrap_files": [
"ios/build-device/Makefile",
"ios/build-simulator/Makefile"
],
"api_schema_files": [],
"has_devcontainer": false,
"typecheck_configs": [
"tsconfig.json"
],
"toolchain_manifests": [
".release-stage/package/android/build.gradle",
"android/build.gradle",
"src-rust/Cargo.toml"
],
"largest_source_bytes": 4025780,
"source_files_sampled": 319,
"oversized_source_files": 40,
"agent_instruction_files": [
".cursor/rules/annadata-app-client.mdc"
],
"agent_instruction_max_bytes": 1323
},
"dependencies": {
"manifests": [
"android/build.gradle",
"desktop/package.json",
"package.json",
"src-rust/Cargo.toml"
],
"advisories": {
"error": null,
"scope": null,
"source": null,
"findings": [],
"collected": false,
"malicious": [],
"truncated": false,
"by_severity": {},
"advisory_count": 0,
"affected_count": 0,
"assessed_count": 0,
"malicious_count": 0,
"assessed_package": null,
"unassessed_count": 0,
"direct_affected_count": 0
},
"ecosystems": [
"crates",
"maven",
"npm"
],
"dependencies": [
{
"name": "wasm-bindgen",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.2"
},
{
"name": "serde",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "1"
},
{
"name": "serde_json",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "1"
},
{
"name": "js-sys",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.3"
},
{
"name": "web-sys",
"manifest": "src-rust/Cargo.toml",
"ecosystem": "crates",
"version_constraint": "0.3"
}
],
"all_dependencies": {
"error": "GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository",
"source": null,
"packages": [],
"collected": false,
"truncated": false,
"total_count": null,
"direct_count": null,
"indirect_count": null
}
},
"maintainership": {
"issues": {
"open_prs": 1,
"merged_prs": 0,
"open_issues": 1,
"closed_ratio": 0,
"closed_issues": 0,
"closed_unmerged_prs": 1
},
"bus_factor": 1,
"bot_contributors": 0,
"top_contributors": [
{
"type": "User",
"login": "arusatech",
"commits": 108,
"avatar_url": "https://avatars.githubusercontent.com/u/119571751?v=4"
}
],
"contributors_sampled": 1,
"top_contributor_share": 1
},
"quality_signals": {
"has_ci": true,
"has_tests": true,
"ci_workflows": [
"ci.yml"
],
"has_docs_dir": true,
"linter_configs": [],
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"security_signals": {
"lockfiles": [
"Cargo.lock",
"package-lock.json"
],
"scorecard": {
"checks": [
{
"name": "Binary-Artifacts",
"score": 0,
"reason": "binaries present in source code",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#binary-artifacts"
},
{
"name": "Branch-Protection",
"score": 0,
"reason": "branch protection not enabled on development/release branches",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#branch-protection"
},
{
"name": "CI-Tests",
"score": null,
"reason": "no pull request found",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#ci-tests"
},
{
"name": "CII-Best-Practices",
"score": 0,
"reason": "no effort to earn an OpenSSF best practices badge detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#cii-best-practices"
},
{
"name": "Code-Review",
"score": 0,
"reason": "Found 0/30 approved changesets -- score normalized to 0",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#code-review"
},
{
"name": "Contributors",
"score": 3,
"reason": "project has 1 contributing companies or organizations -- score normalized to 3",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#contributors"
},
{
"name": "Dangerous-Workflow",
"score": 10,
"reason": "no dangerous workflow patterns detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dangerous-workflow"
},
{
"name": "Dependency-Update-Tool",
"score": 0,
"reason": "no update tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#dependency-update-tool"
},
{
"name": "Fuzzing",
"score": 0,
"reason": "project is not fuzzed",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#fuzzing"
},
{
"name": "License",
"score": 10,
"reason": "license file detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#license"
},
{
"name": "Maintained",
"score": 10,
"reason": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#maintained"
},
{
"name": "Packaging",
"score": null,
"reason": "packaging workflow not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#packaging"
},
{
"name": "Pinned-Dependencies",
"score": 4,
"reason": "dependency not pinned by hash detected -- score normalized to 4",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#pinned-dependencies"
},
{
"name": "SAST",
"score": 0,
"reason": "no SAST tool detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#sast"
},
{
"name": "Security-Policy",
"score": 0,
"reason": "security policy file not detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#security-policy"
},
{
"name": "Signed-Releases",
"score": 0,
"reason": "Project has not signed or included provenance with any releases.",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#signed-releases"
},
{
"name": "Token-Permissions",
"score": 0,
"reason": "detected GitHub workflow tokens with excessive permissions",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#token-permissions"
},
{
"name": "Vulnerabilities",
"score": 6,
"reason": "4 existing vulnerabilities detected",
"documentation_url": "https://github.com/ossf/scorecard/blob/c395761df6afe1a69e476bc60a013a94bcbc153f/docs/checks.md#vulnerabilities"
}
],
"commit": "dff9d7d451c4cd56875dfad6601fbbf7471e4876",
"ran_at": "2026-07-31T14:04:28Z",
"aggregate_score": 2.8,
"scorecard_version": "v5.5.0"
},
"has_codeql_workflow": false,
"has_security_policy": false,
"has_dependabot_config": false
},
"contribution_flow": {
"collected": true,
"ci_last_run_at": "2026-07-27T23:57:24Z",
"oldest_open_prs": [
{
"number": 1,
"created_at": "2025-09-06T15:19:49Z",
"last_comment_at": "2025-09-06T15:19:50Z",
"last_comment_author": "cursor"
}
],
"last_merged_pr_at": null,
"ci_last_conclusion": "FAILURE",
"oldest_open_issues": [
{
"number": 2,
"created_at": "2025-10-06T14:35:31Z",
"last_comment_at": "2026-01-27T04:28:20Z",
"last_comment_author": "asif166037"
}
]
}
},
"config": {
"disabled_metrics": [],
"disabled_categories": [],
"disabled_components": {}
},
"source": {
"url": "https://github.com/arusatech/llama-cpp-pro",
"host": "github.com",
"name": "llama-cpp-pro",
"owner": "arusatech"
},
"metrics": {
"overall": {
"key": "overall",
"band": "moderate",
"name": "Overall health",
"note": null,
"notes": [],
"value": 51,
"inputs": {
"security": 28,
"vitality": 80,
"community": 42,
"governance": 32,
"engineering": 66
},
"components": []
},
"categories": [
{
"key": "vitality",
"band": "good",
"name": "Vitality",
"value": 80,
"weight": 0.22,
"metrics": [
{
"key": "development_activity",
"band": "good",
"name": "Development activity",
"note": null,
"notes": [],
"value": 74,
"inputs": {
"commits_last_year": 127,
"human_commit_share": 1,
"days_since_last_push": 3,
"active_weeks_last_year": 15
},
"components": [
{
"key": "push_recency",
"name": "Push recency",
"detail": "last push 3 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "push_recency",
"params": {
"days": 3
}
}
],
"max_points": 36
},
{
"key": "commit_cadence",
"name": "Commit cadence",
"detail": "15/52 weeks with commits",
"points": 10.4,
"status": "partial",
"details": [
{
"code": "commit_cadence_weeks",
"params": {
"weeks": 15
}
}
],
"max_points": 36
},
{
"key": "commit_volume",
"name": "Commit volume",
"detail": "127 commits in the last year",
"points": 18,
"status": "met",
"details": [
{
"code": "commits_last_year",
"params": {
"count": 127
}
}
],
"max_points": 18
},
{
"key": "openssf_scorecard_maintained",
"name": "OpenSSF Scorecard: Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
},
{
"key": "release_discipline",
"band": "excellent",
"name": "Release discipline",
"note": null,
"notes": [],
"value": 90,
"inputs": {
"releases_count": 2,
"latest_release_tag": "v0.2.2",
"releases_from_tags": false,
"days_since_latest_release": 23,
"mean_days_between_releases": 2.8
},
"components": [
{
"key": "ships_releases",
"name": "Ships releases",
"detail": "2 releases published",
"points": 27,
"status": "met",
"details": [
{
"code": "releases_published",
"params": {
"count": 2
}
}
],
"max_points": 27
},
{
"key": "release_recency",
"name": "Release recency",
"detail": "latest release 23 days ago",
"points": 36,
"status": "met",
"details": [
{
"code": "release_recency",
"params": {
"days": 23
}
}
],
"max_points": 36
},
{
"key": "release_cadence",
"name": "Release cadence",
"detail": "a release every ~2.8 days",
"points": 27,
"status": "met",
"details": [
{
"code": "release_cadence",
"params": {
"gap": 2.8
}
}
],
"max_points": 27
},
{
"key": "openssf_scorecard_signed_releases",
"name": "OpenSSF Scorecard: Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
}
]
},
{
"key": "abandonment",
"band": "excellent",
"name": "Abandonment",
"note": null,
"notes": [],
"value": 100,
"inputs": {
"cap": null,
"state": "maintained",
"guards": [],
"signals": [],
"red_flag": false,
"multiplier_pct": 100,
"declared_reason": null,
"unverified_reason": null,
"unanswered_open_prs": null,
"unanswered_open_issues": null,
"days_since_last_merged_pr": null,
"days_since_last_human_commit": 3,
"days_since_last_human_commit_is_floor": false
},
"components": [
{
"key": "project_is_still_maintained",
"name": "Project is still maintained",
"detail": "last human commit 3 days ago",
"points": 100,
"status": "met",
"details": [
{
"code": "abandonment_maintained",
"params": {
"days": 3
}
}
],
"max_points": 100
}
]
}
],
"description": "Is the project alive — is code being written and are releases shipping?"
},
{
"key": "community",
"band": "at_risk",
"name": "Community & Adoption",
"value": 42,
"weight": 0.18,
"metrics": [
{
"key": "popularity",
"band": "critical",
"name": "Popularity & adoption",
"note": null,
"notes": [],
"value": 15,
"inputs": {
"forks": 3,
"stars": 7,
"watchers": 0,
"growth_state": "unverified",
"growth_factor_pct": 100,
"growth_unverified_reason": "no_history"
},
"components": [
{
"key": "stars",
"name": "Stars",
"detail": "7 stars",
"points": 12.6,
"status": "partial",
"details": [
{
"code": "stars",
"params": {
"count": 7
}
}
],
"max_points": 60
},
{
"key": "forks",
"name": "Forks",
"detail": "3 forks",
"points": 2.5,
"status": "partial",
"details": [
{
"code": "forks",
"params": {
"count": 3
}
}
],
"max_points": 25
},
{
"key": "watchers",
"name": "Watchers",
"detail": "0 watchers",
"points": 0,
"status": "missed",
"details": [
{
"code": "watchers",
"params": {
"count": 0
}
}
],
"max_points": 15
}
]
},
{
"key": "community_health",
"band": "good",
"name": "Community health",
"note": null,
"notes": [],
"value": 70,
"inputs": {
"has_readme": true,
"has_license": true,
"has_contributing": true,
"has_issue_template": false,
"has_code_of_conduct": false,
"has_pull_request_template": false
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 22.5,
"status": "met",
"details": [],
"max_points": 22.5
},
{
"key": "license",
"name": "License",
"detail": "recognized license (MIT)",
"points": 22.5,
"status": "met",
"details": [
{
"code": "license_standard",
"params": {}
},
{
"code": "license_spdx",
"params": {
"spdx": "MIT"
}
}
],
"max_points": 22.5
},
{
"key": "contributing_guide",
"name": "CONTRIBUTING guide",
"detail": null,
"points": 18,
"status": "met",
"details": [],
"max_points": 18
},
{
"key": "code_of_conduct",
"name": "Code of conduct",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 13.5
},
{
"key": "issue_template",
"name": "Issue template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.2
},
{
"key": "pr_template",
"name": "PR template",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.3
}
]
},
{
"key": "ecosystem_adoption",
"band": "at_risk",
"name": "Ecosystem adoption (downloads)",
"note": "Excluded from scoring (no data or not applicable): Registry dependents. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"registry_dependents"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 45,
"inputs": {
"packages": [
"llama-cpp-pro"
],
"dependents": null,
"ecosystems": "npm",
"total_downloads": null,
"monthly_downloads": 495
},
"components": [
{
"key": "monthly_downloads",
"name": "Monthly downloads",
"detail": "495 downloads/month across npm",
"points": 35.9,
"status": "partial",
"details": [
{
"code": "downloads_monthly",
"params": {
"count": 495,
"ecosystems": "npm"
}
}
],
"max_points": 80
},
{
"key": "registry_dependents",
"name": "Registry dependents",
"detail": "not reported by this ecosystem",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_reported_by_this_ecosystem",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Does the project have users, downloads, attention, and a welcoming setup for contributors?"
},
{
"key": "governance",
"band": "at_risk",
"name": "Sustainability & Governance",
"value": 32,
"weight": 0.24,
"metrics": [
{
"key": "maintainer_resilience",
"band": "critical",
"name": "Maintainer resilience (bus factor)",
"note": null,
"notes": [],
"value": 13,
"inputs": {
"bus_factor": 1,
"contributors_sampled": 1,
"top_contributor_share": 1
},
"components": [
{
"key": "bus_factor",
"name": "Bus factor",
"detail": "1 contributor(s) cover half of all commits",
"points": 9,
"status": "partial",
"details": [
{
"code": "bus_factor",
"params": {
"count": 1
}
}
],
"max_points": 54
},
{
"key": "commit_distribution",
"name": "Commit distribution",
"detail": "top contributor authored 100% of commits",
"points": 0,
"status": "missed",
"details": [
{
"code": "top_contributor_share",
"params": {
"share": 100
}
}
],
"max_points": 22.5
},
{
"key": "contributor_breadth",
"name": "Contributor breadth",
"detail": "1 contributors",
"points": 1.4,
"status": "partial",
"details": [
{
"code": "contributors_sampled",
"params": {
"count": 1
}
}
],
"max_points": 13.5
},
{
"key": "openssf_scorecard_contributors",
"name": "OpenSSF Scorecard: Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 3,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "responsiveness",
"band": "critical",
"name": "Issue & PR responsiveness",
"note": null,
"notes": [],
"value": 1,
"inputs": {
"merged_prs": 0,
"open_issues": 1,
"closed_issues": 0,
"issue_closed_ratio": 0,
"closed_unmerged_prs": 1
},
"components": [
{
"key": "issue_resolution",
"name": "Issue resolution",
"detail": "0% of issues closed",
"points": 0,
"status": "missed",
"details": [
{
"code": "issues_closed_share",
"params": {
"share": 0
}
}
],
"max_points": 46.75
},
{
"key": "pr_acceptance",
"name": "PR acceptance",
"detail": "0/1 decided PRs merged",
"points": 0,
"status": "missed",
"details": [
{
"code": "decided_prs_merged",
"params": {
"merged": 0,
"decided": 1
}
}
],
"max_points": 38.25
},
{
"key": "openssf_scorecard_code_review",
"name": "OpenSSF Scorecard: Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
}
]
},
{
"key": "stewardship",
"band": "at_risk",
"name": "Ownership & stewardship",
"note": "Excluded from scoring (no data or not applicable): Verified domain. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"verified_domain"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 39,
"inputs": {
"followers": 3,
"owner_type": "User",
"is_verified": null,
"owner_login": "arusatech",
"public_repos": 18,
"account_age_days": 1338
},
"components": [
{
"key": "ownership_backing",
"name": "Ownership backing",
"detail": "personal (user) account",
"points": 10,
"status": "partial",
"details": [
{
"code": "owner_personal",
"params": {}
}
],
"max_points": 30
},
{
"key": "verified_domain",
"name": "Verified domain",
"detail": "not applicable to user accounts",
"points": 0,
"status": "excluded",
"details": [
{
"code": "not_applicable_to_user_accounts",
"params": {}
}
],
"max_points": 20
},
{
"key": "owner_reach",
"name": "Owner reach",
"detail": "3 followers of arusatech",
"points": 4.3,
"status": "partial",
"details": [
{
"code": "owner_followers",
"params": {
"count": 3,
"login": "arusatech"
}
}
],
"max_points": 25
},
{
"key": "track_record",
"name": "Track record",
"detail": "18 public repos, account ~3 yr old",
"points": 16.6,
"status": "partial",
"details": [
{
"code": "public_repos",
"params": {
"count": 18
}
},
{
"code": "account_age_years",
"params": {
"years": 3
}
}
],
"max_points": 25
}
]
},
{
"key": "package_maintenance",
"band": "excellent",
"name": "Package maintenance",
"note": null,
"notes": [],
"value": 92,
"inputs": {
"packages": [
"llama-cpp-pro"
],
"ecosystems": "npm",
"any_deprecated": false,
"min_days_since_publish": 9
},
"components": [
{
"key": "published_resolvable",
"name": "Published & resolvable",
"detail": "1 package(s) on npm",
"points": 25,
"status": "met",
"details": [
{
"code": "packages_published",
"params": {
"count": 1,
"ecosystems": "npm"
}
}
],
"max_points": 25
},
{
"key": "publish_recency",
"name": "Publish recency",
"detail": "latest publish 9 days ago",
"points": 35,
"status": "met",
"details": [
{
"code": "publish_recency",
"params": {
"days": 9
}
}
],
"max_points": 35
},
{
"key": "version_history",
"name": "Version history",
"detail": "3 published versions",
"points": 12,
"status": "partial",
"details": [
{
"code": "published_versions",
"params": {
"count": 3
}
}
],
"max_points": 20
},
{
"key": "not_deprecated",
"name": "Not deprecated",
"detail": "active, not deprecated or yanked",
"points": 20,
"status": "met",
"details": [
{
"code": "package_not_deprecated",
"params": {}
}
],
"max_points": 20
}
]
}
],
"description": "Will the project survive its people — bus factor, responsiveness, who backs it, and package upkeep?"
},
{
"key": "engineering",
"band": "moderate",
"name": "Engineering Quality",
"value": 66,
"weight": 0.2,
"metrics": [
{
"key": "engineering_practices",
"band": "moderate",
"name": "Engineering practices",
"note": "Excluded from scoring (no data or not applicable): OpenSSF Scorecard: CI-Tests. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"openssf_scorecard_ci_tests"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 60,
"inputs": {
"has_ci": true,
"has_tests": true,
"has_editorconfig": false,
"has_linter_config": false,
"has_precommit_config": false
},
"components": [
{
"key": "ci_workflows",
"name": "CI workflows",
"detail": "1 workflow(s)",
"points": 24,
"status": "met",
"details": [
{
"code": "ci_workflows",
"params": {
"count": 1
}
}
],
"max_points": 24
},
{
"key": "tests_present",
"name": "Tests present",
"detail": null,
"points": 24,
"status": "met",
"details": [],
"max_points": 24
},
{
"key": "linter_config",
"name": "Linter config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 16
},
{
"key": "pre_commit_hooks",
"name": "Pre-commit hooks",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 9.6
},
{
"key": "editorconfig",
"name": ".editorconfig",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 6.4
},
{
"key": "openssf_scorecard_ci_tests",
"name": "OpenSSF Scorecard: CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 20
}
]
},
{
"key": "documentation",
"band": "good",
"name": "Documentation",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"topics": [],
"has_wiki": true,
"homepage": null,
"has_readme": true,
"has_docs_dir": true,
"has_description": true
},
"components": [
{
"key": "readme",
"name": "README",
"detail": null,
"points": 30,
"status": "met",
"details": [],
"max_points": 30
},
{
"key": "documentation_directory",
"name": "Documentation directory",
"detail": null,
"points": 25,
"status": "met",
"details": [],
"max_points": 25
},
{
"key": "documentation_homepage_site",
"name": "Documentation / homepage site",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "repository_description",
"name": "Repository description",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "topics",
"name": "Topics",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 10
},
{
"key": "wiki",
"name": "Wiki",
"detail": null,
"points": 10,
"status": "met",
"details": [],
"max_points": 10
}
]
}
],
"description": "Are baseline engineering and documentation practices in place?"
},
{
"key": "security",
"band": "critical",
"name": "Security",
"value": 28,
"weight": 0.16,
"metrics": [
{
"key": "security_posture",
"band": "critical",
"name": "Security posture",
"note": "Excluded from scoring (no data or not applicable): CI-Tests, Packaging. Remaining weights renormalized.",
"notes": [
{
"code": "excluded_no_data",
"params": {
"components": [
"ci_tests",
"packaging"
]
}
},
{
"code": "weights_renormalized",
"params": {}
}
],
"value": 28,
"inputs": {
"source": "openssf_scorecard",
"checks_evaluated": 16,
"scorecard_version": "v5.5.0",
"checks_inconclusive": 2,
"scorecard_aggregate": 2.8
},
"components": [
{
"key": "binary_artifacts",
"name": "Binary-Artifacts",
"detail": "binaries present in source code",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "branch_protection",
"name": "Branch-Protection",
"detail": "branch protection not enabled on development/release branches",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "ci_tests",
"name": "CI-Tests",
"detail": "no pull request found",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 2.5
},
{
"key": "cii_best_practices",
"name": "CII-Best-Practices",
"detail": "no effort to earn an OpenSSF best practices badge detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 2.5
},
{
"key": "code_review",
"name": "Code-Review",
"detail": "Found 0/30 approved changesets -- score normalized to 0",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "contributors",
"name": "Contributors",
"detail": "project has 1 contributing companies or organizations -- score normalized to 3",
"points": 0.8,
"status": "partial",
"details": [],
"max_points": 2.5
},
{
"key": "dangerous_workflow",
"name": "Dangerous-Workflow",
"detail": "no dangerous workflow patterns detected",
"points": 10,
"status": "met",
"details": [],
"max_points": 10
},
{
"key": "dependency_update_tool",
"name": "Dependency-Update-Tool",
"detail": "no update tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "fuzzing",
"name": "Fuzzing",
"detail": "project is not fuzzed",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "license",
"name": "License",
"detail": "license file detected",
"points": 2.5,
"status": "met",
"details": [],
"max_points": 2.5
},
{
"key": "maintained",
"name": "Maintained",
"detail": "30 commit(s) and 0 issue activity found in the last 90 days -- score normalized to 10",
"points": 7.5,
"status": "met",
"details": [],
"max_points": 7.5
},
{
"key": "packaging",
"name": "Packaging",
"detail": "packaging workflow not detected",
"points": 0,
"status": "excluded",
"details": [
{
"code": "no_data",
"params": {}
}
],
"max_points": 5
},
{
"key": "pinned_dependencies",
"name": "Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 4",
"points": 2,
"status": "partial",
"details": [],
"max_points": 5
},
{
"key": "sast",
"name": "SAST",
"detail": "no SAST tool detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "security_policy",
"name": "Security-Policy",
"detail": "security policy file not detected",
"points": 0,
"status": "missed",
"details": [],
"max_points": 5
},
{
"key": "signed_releases",
"name": "Signed-Releases",
"detail": "Project has not signed or included provenance with any releases.",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "token_permissions",
"name": "Token-Permissions",
"detail": "detected GitHub workflow tokens with excessive permissions",
"points": 0,
"status": "missed",
"details": [],
"max_points": 7.5
},
{
"key": "vulnerabilities",
"name": "Vulnerabilities",
"detail": "4 existing vulnerabilities detected",
"points": 4.5,
"status": "partial",
"details": [],
"max_points": 7.5
}
]
},
{
"key": "high_risk_jurisdiction_exposure",
"band": "excellent",
"name": "High-Risk Jurisdiction Exposure",
"note": "Only high-confidence self-published location evidence affects this multiplier. Ambiguous matches are review-only; country evidence is not proof of nationality, citizenship, legal registration, malicious intent, or sanctions status.",
"notes": [
{
"code": "jurisdiction_evidence_limits",
"params": {}
}
],
"value": 100,
"inputs": {
"meaning": "self-published location evidence; not nationality or citizenship",
"red_flag": false,
"exposures": [],
"policy_countries": [
"Russia",
"Iran",
"North Korea"
],
"review_only_matches": 0,
"assessed_self_published_locations": 2
},
"components": [
{
"key": "policy_exposure_multiplier",
"name": "Policy exposure multiplier",
"detail": "no confirmed policy-scope location match",
"points": 100,
"status": "met",
"details": [
{
"code": "jurisdiction_no_match",
"params": {}
}
],
"max_points": 100
}
]
}
],
"description": "Are visible security and supply-chain practices strong, with no malicious dependency and no unresolved high-risk jurisdiction exposure?"
},
{
"key": "ai_readiness",
"band": "moderate",
"name": "AI Readiness",
"value": 62,
"weight": 0,
"metrics": [
{
"key": "ai_agent_context",
"band": "at_risk",
"name": "Agent context & guidance",
"note": null,
"notes": [],
"value": 49,
"inputs": {
"has_llms_txt": false,
"legible_history_share": 0.07,
"agent_instruction_files": [
".cursor/rules/annadata-app-client.mdc"
],
"agent_instruction_max_bytes": 1323
},
"components": [
{
"key": "agent_instructions",
"name": "Agent instructions",
"detail": ".cursor/rules/annadata-app-client.mdc",
"points": 45,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": ".cursor/rules/annadata-app-client.mdc"
}
}
],
"max_points": 45
},
{
"key": "machine_readable_docs_llms_txt",
"name": "Machine-readable docs (llms.txt)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 15
},
{
"key": "legible_commit_history",
"name": "Legible commit history",
"detail": "7 of 100 human commits state their intent (structured subject or explanatory body)",
"points": 3.7,
"status": "partial",
"details": [
{
"code": "legible_history",
"params": {
"legible": 7,
"sampled": 100
}
}
],
"max_points": 40
}
]
},
{
"key": "ai_verify_loop",
"band": "good",
"name": "Verify loop (build / test / typecheck)",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"has_nix": false,
"has_tests": true,
"lockfiles": [
"Cargo.lock",
"package-lock.json"
],
"has_dockerfile": true,
"typed_language": false,
"bootstrap_files": [
"ios/build-device/Makefile",
"ios/build-simulator/Makefile"
],
"has_devcontainer": false,
"has_linter_config": false,
"typecheck_configs": [
"tsconfig.json"
],
"agent_commit_share": 0.07,
"toolchain_manifests": [
".release-stage/package/android/build.gradle",
"android/build.gradle",
"src-rust/Cargo.toml"
],
"dependency_bot_commit_share": 0
},
"components": [
{
"key": "one_command_bootstrap",
"name": "One-command bootstrap",
"detail": "ios/build-device/Makefile, ios/build-simulator/Makefile",
"points": 18,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "ios/build-device/Makefile, ios/build-simulator/Makefile"
}
}
],
"max_points": 18
},
{
"key": "automated_tests",
"name": "Automated tests",
"detail": null,
"points": 22,
"status": "met",
"details": [],
"max_points": 22
},
{
"key": "lint_format_config",
"name": "Lint / format config",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 11
},
{
"key": "static_type_checking",
"name": "Static type checking",
"detail": "tsconfig.json",
"points": 11,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "tsconfig.json"
}
}
],
"max_points": 11
},
{
"key": "reproducible_environment",
"name": "Reproducible environment",
"detail": "Dockerfile, lockfile",
"points": 10,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "Dockerfile, lockfile"
}
}
],
"max_points": 10
},
{
"key": "demonstrated_agent_practice",
"name": "Demonstrated agent practice",
"detail": "7 of the last 100 commits agent-authored or agent-credited",
"points": 10,
"status": "met",
"details": [
{
"code": "agent_authored_commits",
"params": {
"count": 7,
"sampled": 100
}
}
],
"max_points": 10
},
{
"key": "automated_maintenance",
"name": "Automated maintenance",
"detail": "no automated dependency updates observed",
"points": 0,
"status": "missed",
"details": [
{
"code": "no_dependency_automation",
"params": {}
}
],
"max_points": 8
},
{
"key": "openssf_scorecard_pinned_dependencies",
"name": "OpenSSF Scorecard: Pinned-Dependencies",
"detail": "dependency not pinned by hash detected -- score normalized to 4",
"points": 4,
"status": "partial",
"details": [],
"max_points": 10
}
]
},
{
"key": "ai_code_legibility",
"band": "good",
"name": "Code legibility for models",
"note": null,
"notes": [],
"value": 75,
"inputs": {
"primary_language": "Makefile",
"largest_source_bytes": 4025780,
"source_files_sampled": 319,
"oversized_source_files": 40
},
"components": [
{
"key": "type_checkable_code",
"name": "Type-checkable code",
"detail": "Makefile with type-check config (tsconfig.json)",
"points": 27,
"status": "partial",
"details": [
{
"code": "typecheck_config_language",
"params": {
"files": "tsconfig.json",
"language": "Makefile"
}
}
],
"max_points": 45
},
{
"key": "manageable_file_sizes",
"name": "Manageable file sizes",
"detail": "40/319 source files over 60KB",
"points": 48.1,
"status": "partial",
"details": [
{
"code": "oversized_source_files",
"params": {
"kb": 60,
"sampled": 319,
"oversized": 40
}
}
],
"max_points": 55
}
]
},
{
"key": "ai_interfaces",
"band": "at_risk",
"name": "Machine-readable interfaces",
"note": null,
"notes": [],
"value": 40,
"inputs": {
"example_dirs": [
"examples"
],
"has_mcp_signal": false,
"api_schema_files": []
},
"components": [
{
"key": "api_schema_openapi_graphql_proto",
"name": "API schema (OpenAPI/GraphQL/proto)",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 40
},
{
"key": "mcp_server",
"name": "MCP server",
"detail": null,
"points": 0,
"status": "missed",
"details": [],
"max_points": 20
},
{
"key": "runnable_examples",
"name": "Runnable examples",
"detail": "examples",
"points": 40,
"status": "met",
"details": [
{
"code": "file_list",
"params": {
"files": "examples"
}
}
],
"max_points": 40
}
]
}
],
"description": "How well is the repo equipped to be developed and maintained with AI coding agents? An independent, experimental badge — weight 0.0, so it is surfaced on its own and does not affect the overall health score."
}
],
"metrics_version": "1.13.0"
},
"warnings": [
"Star history unavailable: GitHub GraphQL error: Resource not accessible by personal access token",
"crates package 'llama_engine' points at a different repository (https://github.com/stevedores-org/llama.rs); excluded from ecosystem scoring",
"GitHub dependency-graph SBOM unavailable (404); the dependency graph may be disabled for this repository"
],
"report_type": "repository",
"generated_at": "2026-07-31T14:04:39.494739Z",
"schema_version": "0.27.0",
"badge_url": "https://raw.githubusercontent.com/inspect-software/badges/main/v1/a/arusatech/llama-cpp-pro.svg",
"full_name": "arusatech/llama-cpp-pro",
"license_state": "standard",
"license_spdx": "MIT"
}Las puntuaciones son señales, no garantías. Reflejan prácticas públicamente visibles en GitHub; no son una auditoría de código ni una garantía de seguridad.
Los datos ausentes se excluyen y los pesos se renormalizan; nunca se puntúan como cero. La metodología es versionada y abierta: métricas v1.13.0, esquema v0.27.0 — metodología completa · wiki de métricas.
Cómo se sitúa un resultado dentro del registro general: estadísticas agregadas — npm, crates.io.